KEGG   Zea mays (maize): 606410Help
Entry
606410            CDS       T01088                                 

Gene name
pdi2, PDIL1-2
Definition
protein disulfide isomerase2
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:zma04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 512 aa AA seqDB search
MAIRSKAWISLLLALAAVLSARAEEPAAAEAEAVLTLDVDSFDEAVAKHPFMVVEFYAPW
CGHCKNLAPEYENAAKELSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTLKIFRNQGK
NIQEYKGPREADGIVDYLKKQVGPASKEIKSAEGVAAHFDDKKIYIVGIFKEFSGTEFTN
FMELAEKLSSDYDFGHTLHANHLPRGDASVEGPLIRLLKPFDDLVVDSKDFDVAALEKFI
DASSTPRVVTFDNNPDNHPYLMKFFQSSAPKAMLFLNFSTGPLDSFKSVYYAAAEEFKDK
EIKFLIGDIEASQGAFQYFGLKEDQTPLILIQDGDSKKFLKDHIEADQIVSWLKEYFDGK
LTPFKKSEPIPEVNNEPVKVVVADNIHDVVFKSGKNVLIEFYAPWCGHCKKLAPILEEAA
TTLLSDEEVVIAKMDATANDVPSEFEVQGYPTMYFVTPSGKVTSYDSGRTADDIVDFINK
SKETASAVQATATASGKAADAAEKTEPVKDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccgctccaaggcctggatctcgctgctgctagcgctcgccgcggtgctctcc
gcccgggcggaggagcccgccgcggcggaggctgaggccgtgctcaccctcgacgtcgac
agcttcgacgaggccgtcgccaagcaccccttcatggtcgtcgagttctacgccccatgg
tgtggacattgtaagaaccttgctccagagtacgagaatgcggccaaggaacttagcaag
catgacccaccgattgttctcgctaaggttgatgctaacgaggagaagaacaggccgctt
gctaccaagtacgagatacaagggttcccaaccctcaagatcttcaggaaccaggggaag
aacattcaggaatacaagggccctagggaggctgatggcattgtggattacttgaagaag
caggttggccctgcgtccaaggagatcaagtcagcagaaggtgtggccgcccattttgat
gacaagaagatctatatcgttggaatcttcaaagaattcagtggcactgaatttacaaac
ttcatggagcttgctgagaagctgagttctgattatgactttggacacactttgcacgca
aaccacctcccacgtggtgatgcatctgtggaggggccattgatcaggctgctgaagcct
tttgatgaccttgttgttgacagcaaggattttgatgttgctgctctggagaagtttatt
gatgctagcagcacccctagagttgtcacttttgacaataatcctgacaaccacccatac
ctcatgaagttcttccaaagctcagctcccaaggctatgctgtttttgaacttctccacg
ggaccattggattctttcaagtctgtttactatgctgccgctgaggagttcaaggacaag
gaaatcaagttccttattggtgacattgaagccagccagggtgccttccagtactttggt
ctgaaagaggaccagacaccccttatcctcattcaggatggtgattccaagaagttcttg
aaggatcacattgaggctgaccagattgtctcttggttgaaggagtactttgatggcaaa
ttgacgccgttcaagaagtctgagcctattcctgaggtcaacaatgagcctgttaaggtt
gttgtggctgacaacatccacgatgtggtcttcaagtctggaaaaaatgttcttattgaa
ttctatgccccctggtgtgggcactgcaagaagctggcgcccatcttggaagaggcagcc
accactcttctaagtgacgaggaagttgtgattgctaagatggacgcgaccgccaatgac
gtgcccagtgagttcgaggtccaaggctacccaaccatgtacttcgtgactcccagcggg
aaggtcacctcctacgacagtggcaggacggcggatgacatcgtcgacttcatcaacaag
agcaaggagaccgccagcgccgtccaggcgacggcgacggcatctgggaaggcagctgac
gcagccgagaagaccgagcccgtcaaggacgagctgtaa

DBGET integrated database retrieval system