KEGG   Zea mays (maize): 606411Help
Entry
606411            CDS       T01088                                 

Gene name
pdi3, PDIL1-3
Definition
protein disulfide isomerase3
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    606411 (pdi3)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606411 (pdi3)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   606411 (pdi3)
  Exosomal proteins of colorectal cancer cells
   606411 (pdi3)
  Exosomal proteins of bladder cancer cells
   606411 (pdi3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
4
AA seq 568 aa AA seqDB search
MGSTTMSPPSFPVVLLLLLLATIAAAAGSNMDEEVVDDLQYLIDNSDDIPTNDPDGWPEG
DYDDDDLLFQDQDQDLTGHQPEIDETHVVVLAAANFSSFLASSHHVMVEFYAPWCGHCQE
LAPDYAAAAAHLAAHHHQAHLALAKVDATEETDLAQKYDVQGFPTILFFIDGVPRGYNGA
RTKEAIVDWINKKLGPAVQNVTSVDEAQSILTGDDKAVLAFLDTLSGAHSDELAAASRLE
DSINFYQTSTPDVAKLFHIDAAAKRPSVVLLKKEEEKLTFYDGEFKASAIAGFVSANKLP
LVTTLTQETSPSIFGNPIKKQILLFAVASESTKFLPIFKEAAKPFKGKLLFVFVERDSEE
VGEPVADYFGITGQETTVLAYTGNEDARKFFLDGEVSLEAIKDFAEGFLEDKLTPFYKSE
PVPESNDGDVKIVVGKNLDLIVFDETKDVLLEIYAPWCGHCQSLEPTYNNLAKHLRSVDS
LVVAKMDGTTNEHPRAKSDGYPTILFYPAGKKSFEPITFEGERTVVDLYKFIKKHASIPF
KLKRQESRTESTRAEGVKSSGTNSKDEL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaacaacaatgtcccctccatcttttcccgtcgtcctcctgctcctcctcctc
gccaccatagccgcagccgccggaagcaacatggatgaggaggtggtggacgacctccag
tatcttattgacaactccgacgacatccccaccaacgatcccgacgggtggcctgaggga
gactacgacgacgacgaccttctcttccaagatcaggaccaggacctcacaggccaccag
ccggagatcgacgagacccacgtcgtggtcctcgccgccgcaaacttttcctccttcctc
gcctccagccaccatgttatggttgagttctacgcaccttggtgtggccactgccaggag
ctcgccccggattacgccgccgccgccgcgcatctcgccgctcaccaccaccaggcccac
ctcgcccttgccaaggtcgacgccaccgaggaaaccgacctcgcccagaagtacgacgtc
cagggcttccccaccatcctcttcttcatcgatggcgtccccagaggctataacggagcc
aggaccaaggaagccatcgtcgactggatcaacaagaagctcggcccagccgtgcaaaat
gtcaccagcgtcgacgaggcccagagcatactcaccggagatgacaaagccgtccttgcc
ttcctcgacacactatccggtgctcacagtgatgagcttgctgctgcttcgaggctggaa
gatagcatcaacttttatcagacttcgactcctgatgttgctaagcttttccatatcgat
gcagcagcgaagcgtccatccgtagtgctgctgaagaaagaggaggagaagttgaccttc
tatgatggggagtttaaagcatcagccattgctggttttgtgtctgctaacaagcttcct
ttggtgaccacactaactcaagaaacttccccttctatttttggcaatccaatcaagaag
cagattttactatttgctgttgcaagcgagtccaccaaatttctgcccatctttaaggaa
gcagcaaaaccatttaagggaaagttattatttgtctttgtggaacgagacagtgaggaa
gttggtgaaccagttgccgactactttggtattactggacaagagaccacagttcttgct
tacactggtaatgaagatgctaggaaattttttcttgatggtgaggtgtcacttgaagct
ataaaggacttcgctgaaggtttcttggaagacaagcttacaccattctacaaatcggaa
ccagtgcctgaatctaatgatggggatgtgaaaattgttgttgggaagaatctggatcta
atagtttttgatgaaacaaaagatgtacttcttgagatatatgcaccatggtgtggtcat
tgtcaatcgctggaacctacttacaacaatctagccaagcatctacgtagtgttgactcc
cttgtggtagccaaaatggatggtactaccaatgagcatccacgtgcaaagtctgacgga
tacccgacgattctcttctatccagctgggaagaaaagctttgagccaatcacttttgag
ggggagcggacagtggtagatctgtacaagttcatcaagaaacatgctagcatccctttc
aagttgaagcgccaggagtcgagaaccgagagcactcgggcggagggtgtgaagagctct
ggtacgaactcaaaggacgaactgtaa

DBGET integrated database retrieval system