KEGG   Zea mays (maize): 606413Help
Entry
606413            CDS       T01088                                 

Gene name
pdi6, PDIL2-1
Definition
protein disulfide isomerase6
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606413 (pdi6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 367 aa AA seqDB search
MAISQISRIFLAILLLAAAFAAAPAALADGDDVVALTESTFEKEVGKDRGALVEFYAPWC
GHCKKLAPEYERLGASFKKAKSVLIAKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKK
YEGQRTAEALAEFLNTEGGTNVKLATIPSSVVVLTPETFDSIVLDETKDVLVEFYAPWCG
HCKSLAPTYEKVASVFKLDEGVVIANLDADKHRDLAEKYGVSGFPTLKFFPKGNKAGEDY
DGDRDLVDFVKFINEKSGTSRDTKGQLTSEAGRIASLDVLAKEFLGASGDKRKEVLSSME
EEADKLSGSAARHGKVYVTIAKKILEKGNEYTEKETKRLDRILEKSISPSKADEFIIKKN
VLSTFSS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcccagatctcacgcatattcctggccatccttctcctggccgccgccttc
gccgccgccccagctgcgcttgcggacggcgacgacgtggtggcccttaccgaatccacg
ttcgagaaggaggtcggaaaggaccgcggcgccctcgtcgagttctacgccccctggtgt
ggtcactgcaagaagcttgctcctgagtatgaaagacttggtgcaagttttaagaaagct
aaatctgtcttgattgctaaggttgattgtgatgagcacaagagtttgtgcagcaagtat
ggagtttccgggtatccaacaatccaatggttcccgaaaggatccttggagcccaaaaag
tatgaaggacaacgcactgcagaagcccttgctgaatttctcaatactgaaggaggcaca
aatgtaaagctggcaaccattccttcaagtgttgtggttctcaccccagagacctttgac
tcaattgtccttgatgaaaccaaagatgtccttgttgagttctatgccccatggtgtggt
cactgcaagagtcttgcaccgacgtatgagaaggtggcttctgttttcaagttggatgaa
ggagttgttattgctaaccttgacgctgacaaacacagggatttggctgagaagtatgga
gttagtggatttcctaccttgaagtttttcccaaagggaaacaaagctggtgaagattat
gatggcgatagggacttggttgactttgtcaagttcattaacgagaagagtggtaccagc
cgtgacacaaagggtcaactaacctcagaggctggccgtatagcaagtctggatgtcctg
gctaaggagttccttggtgcttccggtgacaagcgaaaggaagtcctctccagtatggag
gaggaggcagataagctcagtggttctgctgcaaggcatggaaaggtctatgtaaccatc
gcaaagaagattctagagaaaggcaacgagtatactgagaaggaaaccaagaggcttgat
cgcatcttggagaagtccatcagcccctccaaggccgacgagtttatcatcaagaagaac
gttctttcgactttctcatcctaa

DBGET integrated database retrieval system