KEGG   Zea mays (maize): 606414Help
Entry
606414            CDS       T01088                                 

Gene name
pdi7, PDIL2-2
Definition
protein disulfide isomerase7
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    606414 (pdi7)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606414 (pdi7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 366 aa AA seqDB search
MAFPQISRRALGLLLVIAAAAAIVSPATADEVVALTEADFEKEVGQDRGALVEFYAPWCG
HCKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKY
EGQRSVEALAEFVNSEAGTNVKIAAIPSSVVVLTSETFDSIVLDETKDVLVEFYAPWCGH
CKHLAPIYEKLASVFKQDDGVVIANIDADKHTDLAEKYGVSGFPTLKFFPKGNKAGEDYD
GGRDLDDFVKFINEKCGTSRDPKGHLNQEAGLVPSLNPLVKEFLNAADDKRKEVLSKIEE
DVAKLSGSAAKHGKIYVTAAKKIIDKGSDYTKKETERLHRMLEKSISPSKADEFIVKKNI
LSIFSS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccctcagatctcccgcagagccctcggcctcctgctcgtcatcgccgcagcg
gccgcgatcgtctcgcccgccaccgccgacgaggtggtggccctgacggaagccgacttc
gagaaggaggtcggccaggaccgcggcgccctcgtcgagttctacgcgccatggtgtggc
cactgcaaaaagcttgcccccgagtatgaaaaacttggcgccagcttcaagaaggctaaa
tctgtactgatagcaaaggttgactgtgatgagcacaagagtgtatgcagcaagtatgga
gtttctgggtaccccacaattcaatggtttcccaaaggttccctggagccaaagaagtat
gagggtcaacgttctgtggaagcccttgcagaatttgttaacagcgaagcaggtaccaat
gtcaagatagctgccattccttcaagcgtcgtggttctgacttcagagacctttgactca
attgtccttgatgaaaccaaagatgtccttgttgagttttatgccccatggtgtggtcac
tgcaagcatcttgctccgatttatgagaagctggcttcagttttcaagcaggacgacggt
gttgtgattgccaatattgatgctgacaagcacactgacttggctgaaaaatatggtgtt
tctggtttccctacattgaagttcttccctaagggaaacaaagccggtgaagattatgat
ggtggccgggacttggatgactttgtcaagttcattaatgagaagtgtggcaccagccgg
gatccaaagggccacctgaatcaagaggctgggcttgtgccaagcttgaatcctcttgtg
aaggagtttctcaatgctgctgatgacaagcggaaggaagtcctctctaaaatagaagag
gatgttgctaagctcagcggttctgcagccaagcatggaaagatatatgtgacagctgca
aagaagatcatagacaagggctctgactacactaagaaggagactgagaggcttcaccgc
atgctggagaagtcaatcagtccttccaaagctgatgaattcatcgttaagaagaacatt
ctttcgatattctcttcgtga

DBGET integrated database retrieval system