KEGG   Zea mays (maize): 606478Help
Entry
606478            CDS       T01088                                 

Gene name
pdi11, PDIL5-3
Definition
protein disulfide isomerase11
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    606478 (pdi11)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606478 (pdi11)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   606478 (pdi11)
  Exosomal proteins of colorectal cancer cells
   606478 (pdi11)
  Exosomal proteins of bladder cancer cells
   606478 (pdi11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 420 aa AA seqDB search
MAARVLPPPPLPLVLLLLLLPLSARDTVAAGEDFPRDGRVIDLDESNFEAALGVIDFLFV
DFYAPWCGHCKRLAPELDEAAPMLAGLSEPIVVAKVNADKYRKLGSKYGVDGFPTLMLFI
HGVPIEYTGSRKADQLVRNLKKFVAPDVSILESDSAIKNFVENAGTSFPMFLGFGVNDSL
IAEYGRKYKKRAWFAVAKDFSEDVMVAYEFDKVPALVAIHPKYKEQSLFYGPFEENFLED
FVRQSLLPLVVPINTETIKMLNDDQRKVVLTILEDDSDENSTQLVKILRSAASANRDLVF
GYVGIKQWDEFVETFDVSKSSQLPKLLVWDRNEEYELVDGSERLEEGTDQASQISQFLEG
YRAGRTTKKKISGPSFMGFLNSLVSLTSLYILIFVIALLFVMVYFAGQDDTPQPRRIHEE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcggctagagtcctgccgccgccgccgctccctctcgtactcctcttgctgctgctc
ccgctctcagcccgggacaccgtcgccgcgggcgaggatttcccacgcgacgggcgggtg
atcgacctcgacgagagcaacttcgaggcggcgctgggcgtcatcgacttcctcttcgtc
gatttctacgcgccatggtgcggccactgcaagcgccttgcgcccgagttagatgaagct
gcaccaatgttggcagggttgagtgagcccattgttgttgccaaagttaatgctgataaa
tacaggaaacttggatcaaaatatggagttgatgggttccctaccctcatgctttttatc
cacggtgttccaattgaatacactggttcgaggaaggctgatcagcttgtccgcaatctg
aagaagtttgttgcgccagatgtttctatccttgagtcagactctgcgataaagaacttt
gttgagaatgctggtacaagctttcctatgttccttggttttggggtgaatgactcattg
attgctgaatatggaaggaaatacaagaaaagagcatggtttgctgttgctaaagatttc
tctgaggacgtcatggtagcctatgaatttgacaaggttccggcgctagttgcaatccat
ccaaagtataaggaacaaagcttgttctatggcccatttgaagaaaatttcttggaagat
tttgtacgacaatcccttctccctttggttgtcccaatcaatacagagacgataaaaatg
ttgaatgatgatcagaggaaagttgttctcacaattttggaggatgattcagatgaaaat
tctacacagctggtaaagattttgagatctgctgctagcgcaaaccgtgatttggtgttt
ggatatgttggaatcaagcaatgggatgagtttgtggagacttttgatgtttccaaaagc
tcacagctgccaaagctacttgtgtgggatagaaatgaggagtatgagctcgtggatggt
tcagagagattagaagaaggtactgaccaagcatctcaaataagccaatttcttgaggga
tacagagcaggaagaacaacaaagaagaaaattagcggcccttctttcatgggtttcctg
aattctctggtcagcttgacctcgctgtacatccttatattcgtcattgcccttctgttt
gtcatggtgtactttgctgggcaagatgatactccacagccaagacgaattcatgaagag
tga

DBGET integrated database retrieval system