KEGG   Zea mays (maize): 606478Help
Entry
606478            CDS       T01088                                 

Gene name
pdi11, PDIL5-3
Definition
protein disulfide isomerase11
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:zma04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 420 aa AA seqDB search
MAARVLPPPPLPLVLLLLLLPLSARDTVAAGEDFPRDGRVIDLDESNFEAALGVIDFLFV
DFYAPWCGHCKRLAPELDEAAPMLAGLSEPIVVAKVNADKYRKLGSKYGVDGFPTLMLFI
HGVPIEYTGSRKADQLVRNLKKFVAPDVSILESDSAIKNFVENAGTSFPMFLGFGVNDSL
IAEYGRKYKKRAWFAVAKDFSEDVMVAYEFDKVPALVAIHPKYKEQSLFYGPFEENFLED
FVRQSLLPLVVPINTETIKMLNDDQRKVVLTILEDDSDENSTQLVKILRSAASANRDLVF
GYVGIKQWDEFVETFDVSKSSQLPKLLVWDRNEEYELVDGSERLEEGTDQASQISQFLEG
YRAGRTTKKKISGPSFMGFLNSLVSLTSLYILIFVIALLFVMVYFAGQDDTPQPRRIHEE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcggctagagtcctgccgccgccgccgctccctctcgtactcctcttgctgctgctc
ccgctctcagcccgggacaccgtcgccgcgggcgaggatttcccacgcgacgggcgggtg
atcgacctcgacgagagcaacttcgaggcggcgctgggcgtcatcgacttcctcttcgtc
gatttctacgcgccatggtgcggccactgcaagcgccttgcgcccgagttagatgaagct
gcaccaatgttggcagggttgagtgagcccattgttgttgccaaagttaatgctgataaa
tacaggaaacttggatcaaaatatggagttgatgggttccctaccctcatgctttttatc
cacggtgttccaattgaatacactggttcgaggaaggctgatcagcttgtccgcaatctg
aagaagtttgttgcgccagatgtttctatccttgagtcagactctgcgataaagaacttt
gttgagaatgctggtacaagctttcctatgttccttggttttggggtgaatgactcattg
attgctgaatatggaaggaaatacaagaaaagagcatggtttgctgttgctaaagatttc
tctgaggacgtcatggtagcctatgaatttgacaaggttccggcgctagttgcaatccat
ccaaagtataaggaacaaagcttgttctatggcccatttgaagaaaatttcttggaagat
tttgtacgacaatcccttctccctttggttgtcccaatcaatacagagacgataaaaatg
ttgaatgatgatcagaggaaagttgttctcacaattttggaggatgattcagatgaaaat
tctacacagctggtaaagattttgagatctgctgctagcgcaaaccgtgatttggtgttt
ggatatgttggaatcaagcaatgggatgagtttgtggagacttttgatgtttccaaaagc
tcacagctgccaaagctacttgtgtgggatagaaatgaggagtatgagctcgtggatggt
tcagagagattagaagaaggtactgaccaagcatctcaaataagccaatttcttgaggga
tacagagcaggaagaacaacaaagaagaaaattagcggcccttctttcatgggtttcctg
aattctctggtcagcttgacctcgctgtacatccttatattcgtcattgcccttctgttt
gtcatggtgtactttgctgggcaagatgatactccacagccaagacgaattcatgaagag
tga

DBGET integrated database retrieval system