KEGG   Zea mays (maize): 732841Help
Entry
732841            CDS       T01088                                 

Gene name
oy1, ChlI
Definition
(RefSeq) oil yellow1
  KO
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    732841 (oy1)
Enzymes [BR:zma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     732841 (oy1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
10
AA seq 422 aa AA seqDB search
MPLLPLLPVMASTFSPTSAARALLPGSTSRPLFLAASASSGRIQPSRKGLDFRRGRFTVC
NVAAPTAAEQEATASAAKETQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGT
GKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRVLQGDTGLPVTTAKITMVD
LPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSA
ASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIV
EERARFDRDPKTFRESYHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGL
RGDIVTNRAAKALAALKGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEV
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccccttcttcctctcctccccgtcatggcttccaccttctcccccacttccgccgcg
agggccctcctcccgggctccacctcccgcccactcttcctcgccgcttcagcttcctca
gggcgcattcaaccatccaggaagggactggacttccgccgcggccgattcaccgtctgc
aatgtcgccgctcccaccgccgccgaacaggaggcgacggcgtcggccgcgaaggagacc
cagcgccccgtgtacccgttcgcggccatcgtggggcaggacgagatgaagctctgcctg
ctgctcaacgtcatcgaccccaagatcggcggcgtcatgatcatgggcgacaggggcacg
gggaagtccaccaccgtccgctccctcgtcgacctgctcccggacatccgcgtcgtcgtc
ggcgaccccttcaactccgacccggacgaccccgaggtcatgggccccgaggtccgccag
cgggtcctgcagggggacaccggcctccccgtcaccaccgccaagatcaccatggtcgac
ctgcccctcggcgccaccgaggaccgcgtctgcggcaccattgacatcgagaaggcgctc
accgagggcgtcaaggcgttcgagcccggcctgctcgccaaggccaacaggggcatactg
tacgtcgacgaggtcaacctgctggacgaccacctcgtcgacgtgctgctggattccgct
gcgtcggggtggaacacggtggagagggagggtatctccatatcccaccctgctcgcttc
atcctcatcggctctggtaacccggaggaaggggagctcaggccccagctgctggaccgg
ttcgggatgcacgcgcaggttggtaccgtcagggacgccgagctcagggtgaagatcgtg
gaggagagggctcgtttcgacagggatccgaagacgttccgtgagtcgtatcatgacgag
caggagaagctccagcagcagatatcatctgcacggagtaaccttggcgctgtgcagatt
gaccatgacctccgtgtcaagatatccaaggtgtgctctgagttgaacgttgatggactc
agaggtgacattgtgactaacagggctgccaaggcgctggctgcgttgaaaggaagggac
agcgtcaccgtggaggacattgctactgtcattccaaactgcttgaggcatcggctccgc
aaggatccgcttgaatccattgactcgggtttacttgtcattgagaagttttatgaagtc
tttagctag

DBGET integrated database retrieval system