KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0096Help
Entry
ZZ6_0096          CDS       T02187                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00010  Glycolysis / Gluconeogenesis
zmb00350  Tyrosine metabolism
zmb00625  Chloroalkane and chloroalkene degradation
zmb00626  Naphthalene degradation
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01120  Microbial metabolism in diverse environments
zmb01130  Biosynthesis of antibiotics
zmb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZZ6_0096
  Lipid metabolism
   00071 Fatty acid degradation
    ZZ6_0096
  Amino acid metabolism
   00350 Tyrosine metabolism
    ZZ6_0096
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZZ6_0096
   00626 Naphthalene degradation
    ZZ6_0096
Enzymes [BR:zmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZZ6_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C CoA_binding TrkA_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFN56001
Position
104303..105316
Genome map
AA seq 337 aa AA seqDB search
MKAAVITKDHTIEVKDIKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKEMGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtcataaccaaagatcatacgatcgaagtgaaagacatcaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccatgtaaaaaacggggattttggcgatgaaaccggcagaattaccggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgcgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagcgggaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggtgctatggccgaagaa
tgcatcgtcgttgccgattactcggtcaaggtgccagatgggcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccggggcaatggctggccatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagatgggcgcagatatggtcatcaatccgaaaaacgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcaacggtggtgacggctgttgccaaatcc
gcctttaactcggctgttgaagctatccgcgcgggtggccgtgttgtcgccgttggtctg
cctcctgaaaaaatggatttgagcattcctcgtttggtgcttgacggtatcgaagtctta
ggttctttggtcggaacgcgggaagatttgaaagaggccttccagtttgcagccgaaggc
aaggtcaaaccgaaagttaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggaaaattcacaggccgtatggttgtggattttacccacaaatag

DBGET integrated database retrieval system