KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0096Help
Entry
ZZ6_0096          CDS       T02187                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ZZ6_0096
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZZ6_0096
  Lipid metabolism
   00071 Fatty acid degradation
    ZZ6_0096
  Amino acid metabolism
   00350 Tyrosine metabolism
    ZZ6_0096
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZZ6_0096
   00626 Naphthalene degradation
    ZZ6_0096
Enzymes [BR:zmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZZ6_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
104303..105316
Genome map
AA seq 337 aa AA seqDB search
MKAAVITKDHTIEVKDIKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKEMGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtcataaccaaagatcatacgatcgaagtgaaagacatcaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccatgtaaaaaacggggattttggcgatgaaaccggcagaattaccggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgcgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagcgggaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggtgctatggccgaagaa
tgcatcgtcgttgccgattactcggtcaaggtgccagatgggcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccggggcaatggctggccatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagatgggcgcagatatggtcatcaatccgaaaaacgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcaacggtggtgacggctgttgccaaatcc
gcctttaactcggctgttgaagctatccgcgcgggtggccgtgttgtcgccgttggtctg
cctcctgaaaaaatggatttgagcattcctcgtttggtgcttgacggtatcgaagtctta
ggttctttggtcggaacgcgggaagatttgaaagaggccttccagtttgcagccgaaggc
aaggtcaaaccgaaagttaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggaaaattcacaggccgtatggttgtggattttacccacaaatag

DBGET integrated database retrieval system