KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0106Help
Entry
ZZ6_0106          CDS       T02187                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZZ6_0106
Enzymes [BR:zmb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ZZ6_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
117298..117903
Genome map
AA seq 201 aa AA seqDB search
MEEIQDLAVMRPDQVNVPEEIQEAIRSLIRWAGDDPDREGLIDTPKRVAKAWKYYCRGYR
EDPENHLKTVFEEVGGYDDIVLLKDIPFYSHCEHHMAPIMGHAHIAYLPDKKVVGLSKLA
RVLKGYAHRLQIQERLTAQVADCIWNNLRPRGVAVVISAVHSCMAARGVETPNVQTVTKT
LRGIYSEDSEQAKMILNLMGV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatacaagatctggcggttatgcgcccggatcaggtcaatgtgccggaagaa
atacaggaagccattcgcagccttatccgttgggcgggtgatgatcctgatcgggaaggc
ctgattgatacgccaaagagggttgccaaggcgtggaaatattattgtcgggggtatcgg
gaagaccctgaaaaccatttaaaaaccgtttttgaagaagtcggcggctatgacgatatt
gtgctgctgaaagatattcctttctattcgcattgcgaacatcatatggcaccgattatg
gggcatgcccatatcgcctatttgccggataaaaaggttgttggcctgtcaaaactggcg
cgggtgctgaaagggtatgcccatcgcttgcaaatacaggaaagactgacagcacaggtg
gccgattgtatctggaataatctccgcccacgcggtgttgcggtggttatttctgcggtg
catagctgtatggccgcacgtggggtcgaaacccccaatgtccagaccgtcaccaaaacg
ctacgcggtatttacagcgaagactctgaacaggccaaaatgatccttaatcttatgggt
gtgtaa

DBGET integrated database retrieval system