KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0150Help
Entry
ZZ6_0150          CDS       T02187                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ZZ6_0150
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ZZ6_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165760..166608
Genome map
AA seq 282 aa AA seqDB search
MPKLTEIAYAKINLALHVRGKMPNGYHALETIFAFAKDGDILQAEVNDTEDNLTITGPFS
EGLEANKDNLVLRAVTALRQACPNKIPAGFSIILDKRLPVAAGIGGGSADAAAMLRMIGQ
HYQIPHELLLSLANSLGADVPACVDSCLVRGEGVGEKLTQIGDRSLEDKPLLLVNPRVSC
STPMIFKNWDGIDRGALDSDGSILNAARSGRNDLEPPARKILPIIGEVVEWLQQQKGVSF
SRMSGSGATCFALFDEIEDRDTVYKKLNIDHPEWWTLSSLLR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaagctaacagaaatagcctatgccaaaatcaatctggcgcttcatgtgcgggga
aaaatgccgaatggttatcacgcattagagactatttttgcttttgctaaagatggcgat
attctccaagccgaagtgaatgatacagaagataatttaacgattacgggtcctttttca
gaaggattagaagccaataaagataatcttgttttaagggcagtcacagctttacggcag
gcctgtcctaataaaatacccgctggattttctattattcttgataaaagattgcccgtt
gcagctggtattggcggcggatcagctgatgctgcggctatgctacggatgatcgggcaa
cattatcaaattcctcatgaactgcttttatcccttgctaatagtctgggtgcagatgtg
cctgcttgtgttgattcctgtttagtaagaggggaaggcgttggcgaaaaactgacacag
attggtgaccggtctttagaagacaaacccctattattggtaaatcctagagtatcctgt
tcgaccccaatgatttttaaaaactgggatggtattgatcgaggcgcattggatagcgat
gggtctatattaaatgccgcccgatctgggcgtaatgatttggagccaccggcaaggaag
atattgccgattattggagaagtcgttgagtggttacaacaacaaaaaggggtcagtttt
tctcggatgtcaggatcgggagcaacttgtttcgcacttttcgatgaaattgaagaccgg
gatacggtctacaaaaaattgaatattgaccatccagagtggtggactttgtcgtcatta
ttacgatga

DBGET integrated database retrieval system