KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0160Help
Entry
ZZ6_0160          CDS       T02187                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZZ6_0160
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ZZ6_0160
Enzymes [BR:zmb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ZZ6_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180887..181921
Genome map
AA seq 344 aa AA seqDB search
MKPVFIGIADTRLSDQEKKLFRQYEPAGYILFQRNITDRTQLKKLTADLRANSQQNIPIL
IDQEGGRVARMKPPVWPAFPAAARFDELYQKAPVSAIEAVRANSHALALLLQDVGINVDC
MPLLDIRDPEGDNIIGDRSFGHNPEQVAALGQAVLDGLAKGCVCGIIKHIPGHGQAKVDS
HKALPVVDSPIEILERDIRPFQHLRNAKMAMTAHIIYQAWDKESCASYSSKIIHDIIRKK
IGFKGLLMSDDIGMNALDGDPVTRALRVFDAGCDIALHCSGKFDETKAILENIDEIRPES
FAALKKVTNEFSSASDFDLDRAENKALFDRCIAERDALFLEAAV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtttttattggtatcgctgatactagattatcagatcaggaaaaaaagcta
ttccgtcaatatgaacctgccggttatattctttttcagagaaatattacagaccgtacg
cagctaaagaaattgacggcagatttgagagccaatagccaacagaatattccaatttta
attgatcaggagggggggcgggtcgccagaatgaaaccgccagtctggccagcttttcct
gccgccgcccgatttgatgagctttatcaaaaagcgccggttagtgcgattgaagctgtc
cgtgccaatagccatgcactggctttattgttacaggatgttggcatcaatgttgattgt
atgccgttattggacatccgtgatcctgaaggtgataacatcatcggagatcgctctttt
ggtcataatcccgaacaagtcgcagccttaggacaagcggtattagacgggttggcaaaa
ggctgcgtttgcggcattattaaacatattccgggacatggccaagccaaagtggacagt
cacaaagccttgccagtggttgatagtcctattgaaatattggaacgggatatcaggcct
tttcaacatttacgtaatgccaaaatggcgatgaccgcccatattatttatcaggcatgg
gacaaggaaagctgcgccagctattcttcaaaaattatccacgatattattcgcaaaaaa
atcggttttaaaggccttcttatgtccgacgatatcggcatgaatgctttggatggtgat
ccggtaacacgggcgctacgcgtttttgatgccggttgcgatatagcgctccattgctcc
ggaaaattcgatgagacgaaagctattttagaaaatatagatgagatcagaccagaaagc
tttgctgccttgaaaaaggtaaccaatgaattttcaagcgcttctgattttgatttggat
agagcagagaataaagctctttttgatcgctgcattgccgagcgcgatgctttatttcta
gaagcggcagtctag

DBGET integrated database retrieval system