KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0416Help
Entry
ZZ6_0416          CDS       T02187                                 

Definition
putative CheA signal transduction histidine kinase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:zmb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:zmb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476685..478358
Genome map
AA seq 557 aa AA seqDB search
MTQPEKKLFTLWQAQKKTIENDLKACQAGIYDSKCLLRLEMAIKELNNQASGNNETALVQ
LTFLLAQLIEAIRKDRLALNLFLIDLIQRSFDTIENYILTITSKQIPVDQTQIEEELQKT
IAHSSQYAIKKVGHEITIDKPEVILSKNALVADDPVTRIHQNTTDEALHVEGSLEPHIPV
NPEKLDNLFDIFHEMLSIRSELSLTHGLSDEKAGRVNALEKLDQLIQSANNYAMALQTQT
IEPLFKQVIDIIKQRCGNNHKNIIFSVIGSEIKIDKRIVIDLGKALLELVDNAAFHGIEE
SETRQEMGKPREGHIRLEARYHASRLKIIIADDGCGILWEKLVKIAEQYGIIADKDAPDR
KEDETQSFESHASYHGKGGFATVKDIVQSLKGEIRIYAPPRLGTRVTMLLPLNQTMVEGL
ITTVKDQSYILPISDIVESIAVNAEDIHWVDERQSMIQLRDQWFPAIALSALLGEENFTQ
DSFKTGRKILIRIDPMIHQPEVMIIVDALESQRQVLVQSLEKNFQAVYGISGVAFLQEGQ
TALVVDIDSLLNPHKYS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccgaaaaaaaactgtttactttatggcaagcccaaaaaaaaacgatcgaa
aatgatctaaaggcctgtcaggccggtatctacgacagcaaatgcctgctccgtctggaa
atggcgataaaagaactgaataatcaggcttctggcaataatgaaacagcgttagttcag
ttaacttttttactagcgcaactgatagaagcgatccgcaaagatcgcttggctttaaat
ctgttcttaattgatctgatccagcgtagttttgatacgatcgagaattatattctgacc
attacatcaaaacagattccggttgaccagacccagattgaagaagaattacaaaagaca
atcgcccattcttctcaatatgcgattaaaaaagtcggtcatgaaatcactatagacaag
ccagaagtcattttatccaaaaatgctctggtggccgatgatcccgtaacgcgtatccat
caaaataccacggatgaagcccttcacgttgaaggcagtcttgaaccgcatattccagtt
aatcctgaaaaattggataatctattcgatatattccacgagatgcttagcattcgttca
gaattaagtctcactcatggcctttcagatgaaaaagccggtcgggtcaatgcgctcgaa
aaattggatcaattgatccaatctgccaataattatgccatggcgctccaaacgcagact
atcgagccgctttttaaacaagtcattgatattattaagcaaagatgcggtaataatcac
aaaaatatcattttttcagttatcggatctgaaatcaaaatcgacaaacggatcgtcatt
gatcttggcaaggctttacttgaactcgtcgacaatgcggcctttcacggcatcgaagaa
agcgaaacacgtcaggaaatgggtaaacctcgcgaaggccatattcgcttggaagcccgc
tatcatgccagccgcttaaagatcattatcgccgatgatggctgtggcattctttgggaa
aaactggtcaaaatcgccgaacaatacggcataattgcagataaagatgctccagatagg
aaagaagacgaaacgcaatcttttgaaagtcatgcctcgtatcatgggaaaggcggcttt
gcgaccgtcaaagacattgttcagtcattaaagggagaaatacgcatttatgcccctccc
cgtttaggcacgcgggtcacgatgcttctaccccttaatcaaacgatggttgaaggcctg
attaccaccgtcaaagatcaaagctatattctgcctatctccgatatcgtcgaaagcatc
gcggtcaatgcagaagatattcattgggtcgatgaaagacagtcgatgatccaactacgg
gatcaatggtttccggctattgcgctttctgccttattgggagaggaaaatttcacacag
gattcttttaagacaggccgaaaaatcctgatcagaattgacccgatgattcaccaacca
gaagtgatgattatcgttgatgctcttgaaagccaaagacaggttttagttcaaagcctc
gaaaaaaatttccaagctgtgtacggtattagtggggttgcttttctacaagaaggtcaa
acggctctagttgttgacatagactccttattaaaccctcacaaatacagttaa

DBGET integrated database retrieval system