KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0480Help
Entry
ZZ6_0480          CDS       T02187                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZZ6_0480
DNA repair and recombination proteins [BR:zmb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ZZ6_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(553694..554290)
Genome map
AA seq 198 aa AA seqDB search
MSASPIENLIKSLAVMPGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECG
NIDSCNPCSICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALDGITPED
LSIDALVKRVQSGKIKEVVLAMNATLEGQTTAHYITDCLEKYPVRITQLAHGLPVGGELD
YLDDGTLAQALRARRPVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctcctatagaaaatcttatcaagagtctggctgttatgcccggattgggc
ccgcgatcagcaaggcgggcggcgctctatctgattaagaagagagaaaccgcgctttat
aatctggcgcaggctttggacgaggtgcagcagtcactggttatctgtcctgaatgtggc
aatattgatagctgcaatccttgttcgatctgttctgaccctaagcgggatgatgccttg
ctatgtgttgtcgaagaggttgctgatttatgggcacttgatcggtcgcgtttatttgcg
gggcgctttcatgtccttggcgggcggttatcggccttggatgggataacgcccgaagat
ctgtcgattgatgcccttgtgaagcgggttcaatcgggaaaaattaaagaggttgtcttg
gccatgaatgccacgttagaaggccagacgaccgcgcattatataacggattgtttagaa
aaatatccggtaagaattacccaattggcgcatggtcttcctgtaggaggggagcttgac
tatttagatgatggcactttagcgcaagctttgcgtgccagacgacctgtatcatga

DBGET integrated database retrieval system