KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0551Help
Entry
ZZ6_0551          CDS       T02187                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:zmb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(635961..636779)
Genome map
AA seq 272 aa AA seqDB search
MLLSSLSPQAALLEGLVQIALQAGKRALEIYHGDFTVMKKDDDSPVTQADREAEAIILQG
LKKLQPGVAVIAEEEYAKTKKGYNTDSFFLVDPIDGTQEFVNKRDEFTVNIALIKKAYPI
LGVIYAPAINRLYAGDVLAKTAWAADVTDDFQIENRTNIAIRQAGEKWDVMTSFSHNNPT
TEEYLKQLPIGERIKAGSSLKFCLLAEGKADIYPRLSPTHEWDTAAGQAILLAAGGNVID
EKGENLMYGKPGYRNPGFIAYGSEQPPLLVEK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatcatcactttcgccgcaggctgcgttattagaaggtctggtacaaattgcg
ctacaggccggaaaacgggcgctcgaaatttatcatggtgattttaccgtgatgaagaaa
gatgacgatagccccgtaacacaggcggatcgtgaggctgaagcgattattttacaggga
ttgaaaaagctgcaacccggtgttgccgtcatcgcagaagaagaatacgccaaaaccaag
aaggggtataataccgacagctttttcttggttgatccgattgatggcacgcaagaattt
gtcaacaaacgggacgaatttacggttaatattgccctgattaaaaaagcctaccctatt
ttgggtgtcatttatgcgccagctatcaaccgtctttatgctggtgatgtcttggcaaaa
accgcatgggcagccgatgtaaccgacgattttcaaatagaaaaccggactaatatcgca
atccgtcaagcgggtgaaaaatgggatgttatgacgtctttttcccataataacccgaca
actgaagagtatttgaagcaattacctatcggagagcggattaaggccggttcttctttg
aaattctgtttattggcagaaggcaaagcggatatttatccccgattgtcccctacccat
gaatgggatacggctgctggtcaggctattcttttggctgctggtgggaatgtgatcgat
gaaaaaggcgaaaatctgatgtatgggaaaccggggtatcggaatcccggatttattgcc
tatggttcagaacaaccaccattacttgtagaaaaataa

DBGET integrated database retrieval system