KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0685Help
Entry
ZZ6_0685          CDS       T02187                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZZ6_0685
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZZ6_0685
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZZ6_0685
Enzymes [BR:zmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZZ6_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786668..787894
Genome map
AA seq 408 aa AA seqDB search
MKQSNSVLPNSLRAQPDAGGHFGTFGGQYVPETLMPIILELNQEYRRALKDPSFIAERDD
LLEHYVGRPSPLYFAPRLTEAWGGAKIYLKREDLNHTGAHKINNCIGQVLLAKRMGKTRV
IAETGAGQHGVATATVAARFGLSCTVFMGELDTERQQPNVFRMKLLGAEVRPVKAGSRTL
KDAMNEALRDWVAHIDDTFYILGTAAGPHPYPEMVRDFQSVIGREAREQIQKAEKRLPDL
LIAAVGGGSNAMGLFHPFLDDTDVAMIGVEAAGEGMETGRHAASLTGGAPGIVHGNRTYL
LYDENGQIKDAHSISAGLDYPGIGPEHSWLKDIKRVRYETITDNEALAAFQQLCRLEGII
PALESSHALAEAAKIAPTMGKDKIIIVNLSGRGDKDIYTVASHLGVAL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatctaattctgttcttccgaattctcttcgcgcccaaccggatgcaggcggg
cattttggcacattcggcggacaatatgttcccgaaaccctgatgccgattattcttgag
cttaatcaggaatatcggcgcgcattgaaagacccgtcattcatagcagaaagagatgat
ctgctagagcattatgtcggtcgtcctagcccgctttatttcgcgcctcgcctgacagaa
gcctggggcggcgcaaaaatctatttgaagcgtgaagatcttaatcatacgggtgcgcat
aaaatcaataactgcatcggtcaggtcttattagcgaaaagaatgggtaaaacccgcgtt
atcgcggaaactggtgccggacagcatggtgtcgcaacggcgaccgttgcggctcgcttt
ggtctatcttgcacggtctttatgggtgaactggatacagagcgccagcaacccaatgtc
tttagaatgaaattgttgggtgccgaggttcgtcccgttaaagcgggttcccgcaccttg
aaagacgccatgaatgaagccctgcgtgattgggtggctcatattgatgacactttctat
attcttggcacggcagcaggcccccatccctatcctgaaatggtgcgtgatttccaatcc
gtgattggacgcgaagccagagagcagattcaaaaagcagaaaagcgtttaccggattta
ttgatcgcagccgttggcggtggatcaaatgctatggggcttttccatcctttccttgat
gatacagatgtcgctatgattggtgtcgaggccgcgggtgaaggcatggaaaccggtcgt
catgcagccagcttaacgggcggcgcaccgggtatcgtccatggaaaccgcacctatctt
ctttatgatgagaatggtcagattaaagatgcccattcgatttcagccggcctggattat
cctggtattggccctgaacatagctggttaaaagacataaaacgtgtccgttatgaaacc
attacggataacgaagccttggccgctttccagcagctttgccgattagagggcattatt
ccggcattggaatcttcccatgctttggcagaagccgccaaaatagccccgacaatgggc
aaagacaaaatcattattgttaatctttcagggcgtggcgacaaagatatctataccgta
gccagccatttaggggtcgcgttatga

DBGET integrated database retrieval system