KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0686Help
Entry
ZZ6_0686          CDS       T02187                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZZ6_0686
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZZ6_0686
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZZ6_0686
Enzymes [BR:zmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZZ6_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
787891..788715
Genome map
AA seq 274 aa AA seqDB search
MSRIANTFAKTKKENRAALIAFLTAGDPSIEATPALLDSLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTGYNDIFRIATEFRKRHPETPLILMGYANPMTFKGSDSFAASAKD
AGVDGIICVDIPPEEDATLGVAVREKGMDMIRLATPTSDEARLKIILDGASGFLYYVSVA
GVTGLQQATEASIDAALDRIKSVTDLPVAVGFGIRSPEQAAAIAKKADAVVVGSAFVSCI
EKAVTNRQDPNAALEKLAKELSTAISDARKEAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgccaatacttttgccaaaacaaaaaaagaaaatcgggctgctttgatt
gcctttctgacggcaggtgatccctctattgaagcgacccctgccctgttggatagtctg
gttgaaaatggcgttgatattatcgaattaggtatgcccttttctgatccgatggcagat
ggccccgctattcagaaagccaatcttcgggctttggcggctaaaactggctataatgac
atctttagaatagccacggaatttagaaaacggcatccagaaacgccgcttatccttatg
ggatatgccaatccgatgacgtttaaaggcagcgacagctttgccgcctctgcaaaagac
gccggtgttgacggcattatctgtgtcgatattccgcctgaagaggatgcaacccttggt
gtcgcagtgcgcgaaaaaggcatggatatgatccggcttgccaccccgaccagcgatgaa
gcccgtttaaaaatcatcctcgatggggcttccggtttcctttattatgtttctgtcgca
ggcgttacgggtctgcaacaggcaaccgaagccagtattgatgccgcgcttgatcggatt
aaatctgtaacagatttaccggttgccgtcggtttcggtattcgttcaccagaacaggcc
gcagcgattgccaaaaaggctgatgcggttgtggtgggttcggcctttgtatcctgcatc
gaaaaggctgtgaccaatcgccaagatcccaatgcagccttagagaaattggctaaagaa
ttaagcacggccatttccgatgcccgtaaggaggccgccctatga

DBGET integrated database retrieval system