KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0699Help
Entry
ZZ6_0699          CDS       T02187                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZZ6_0699
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZZ6_0699
   00650 Butanoate metabolism
    ZZ6_0699
  Energy metabolism
   00190 Oxidative phosphorylation
    ZZ6_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
804912..805298
Genome map
AA seq 128 aa AA seqDB search
MMNSYSDSPLSGNHRYRDSHRTDFYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWAA
QTIVALPMIFLAISTYGYACSFVDKLFLEERFPKAGLYFQIAAYFYMIIFAAIAVFSILK
IAFHSGIS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcttacagtgacagcccgctatctggaaatcaccgttatcgtgatagccat
cgaaccgatttttataaaaaacttacggcggcggctaatcttcttttatatgtttggttg
atcgtctcttttctggaattaccggtctatgattttaatgtcattagacgttgggcagcc
cagaccatagtcgccttgccgatgatttttctggctatatcgacctatggctatgcctgt
tcttttgtagataaactgtttttagaggagcgttttccaaaagcagggctgtatttccag
atagccgcctatttttacatgataatttttgcagcgatcgcggtcttttcaattctgaaa
atcgcttttcattctggtataagctaa

DBGET integrated database retrieval system