KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0720Help
Entry
ZZ6_0720          CDS       T02187                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01130  Biosynthesis of antibiotics
zmb01230  Biosynthesis of amino acids
Module
zmb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZZ6_0720
Enzymes [BR:zmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ZZ6_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: AFN56615
Position
831896..832690
Genome map
AA seq 264 aa AA seqDB search
MSNILTEICATKAEFVAERKKQIGNNALLDLIKAQTQPRGFRAALEKKRARGQFGLIAEI
KKASPSKGLIRSDFTPAAHAHDYEEGGAACLSVLTDRPYFQGHEDYLIAARKAVKLPVLR
KDFMIDPWQVTEARAIGADAILIIVAALDDQQMQDIEAAALEYGMDALVEVHSHDEMERA
LKLKSRLIGVNNRDLRDFSVSFDRTYELVGSAPKDCTFVAESGIRNHDDLVAMQRHDIGC
FLVGETLMRQDDLRKATKDLLGLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattcttacagagatctgcgctaccaaggcagaattcgtggcagaacgaaaa
aaacagattgggaataatgcccttcttgatttgataaaggcacagacgcaaccccgtggt
tttcgagctgccctagaaaaaaagagagcgcgagggcaattcgggcttattgcagaaatc
aaaaaagcaagtccttcaaaagggttaatccgttctgatttcacaccggcagcccatgcc
catgactatgaagaaggtggtgccgcctgtttatccgttttaacagatcgcccctatttc
caaggccatgaagattatttaatcgctgccagaaaagcggtaaagttacccgtccttcgt
aaagattttatgattgacccgtggcaggtaaccgaagctagagccatcggtgccgatgcg
atcttgattatcgttgcggccttggacgatcaacagatgcaggatattgaagccgccgct
ttggaatatggcatggatgctttggtagaagtccatagtcatgatgagatggagcgggcg
ttaaaattgaaatcccgtcttattggcgtcaataatcgcgatttgcgagacttttcggtc
agttttgaccgcacctatgaattagtgggttcagcccccaaagattgcacctttgttgcg
gaaagcggtatccgcaatcatgatgatttggtggctatgcagcgtcatgacattggctgt
tttttagtaggtgaaactttaatgcggcaagatgatctgagaaaagccacaaaggattta
ttgggattatcctaa

DBGET integrated database retrieval system