KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0798Help
Entry
ZZ6_0798          CDS       T02187                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZZ6_0798
   01230 Biosynthesis of amino acids
    ZZ6_0798
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZZ6_0798
   00051 Fructose and mannose metabolism
    ZZ6_0798
   00562 Inositol phosphate metabolism
    ZZ6_0798
Enzymes [BR:zmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZZ6_0798
Exosome [BR:zmb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZZ6_0798
  Exosomal proteins of bladder cancer cells
   ZZ6_0798
  Exosomal proteins of melanoma cells
   ZZ6_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
911849..912598
Genome map
AA seq 249 aa AA seqDB search
MTIRKLIAGNWKMNGSLGMLHELDGIAKATFNHPELDVVICPSFTLIAPAIVRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRIEQNETNEEIRAKTTTAIANGLV
TIVCIGESRAAHASGQALPIIGAQLDGCIPPDATSDNLVVAYEPIWAIGTGNTPPPESIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAEELMAIPDVNGTLVGGASLTAEQFVP
IIEAGGRLA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacgcaagctcatcgccggcaattggaaaatgaacggttctttaggcatgttg
cacgaactggacgggatcgccaaggcaacctttaaccatccagaacttgatgttgtgatt
tgtccatccttcacgctgatagcgcccgctattgtgcggcaacccgatatgaccttcggg
gcgcaagattgccattatgatgaaagtggttcgcataccggctgtgtttcggcaccgatg
ctccgtgaggtcggtgcaagttatgtcatcgttggccatagcgaaagacgtattgaacag
aatgaaaccaatgaagagatccgagcaaaaacgacaacggccatagccaatggccttgtg
acgattgtttgtattggcgaatcccgtgctgcccacgcatccgggcaggctttgcctatc
attggggcgcagctggatggctgtattccgccagatgccaccagcgataatctagttgtt
gcctatgaacccatctgggctatcggaacggggaataccccaccgcctgaaagcattgcc
gaaatgcacgcctcgattcgtgaccgcttatgcttgttactaggaagcgaagggaagaag
gtccgcatcttatatggaggctctgttaccggcaaaaatgccgaagaattgatggccatt
ccagatgtcaatggaactctggtcggtggcgccagccttaccgcagaacaatttgttcct
atcattgaagctgggggacgtttggcctag

DBGET integrated database retrieval system