KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0798Help
Entry
ZZ6_0798          CDS       T02187                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00010  Glycolysis / Gluconeogenesis
zmb00051  Fructose and mannose metabolism
zmb00562  Inositol phosphate metabolism
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01120  Microbial metabolism in diverse environments
zmb01130  Biosynthesis of antibiotics
zmb01200  Carbon metabolism
zmb01230  Biosynthesis of amino acids
Module
zmb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZZ6_0798
   00051 Fructose and mannose metabolism
    ZZ6_0798
   00562 Inositol phosphate metabolism
    ZZ6_0798
Enzymes [BR:zmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZZ6_0798
Exosome [BR:zmb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZZ6_0798
  Exosomal proteins of bladder cancer cells
   ZZ6_0798
  Exosomal proteins of melanoma cells
   ZZ6_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFN56692
Position
911849..912598
Genome map
AA seq 249 aa AA seqDB search
MTIRKLIAGNWKMNGSLGMLHELDGIAKATFNHPELDVVICPSFTLIAPAIVRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRIEQNETNEEIRAKTTTAIANGLV
TIVCIGESRAAHASGQALPIIGAQLDGCIPPDATSDNLVVAYEPIWAIGTGNTPPPESIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAEELMAIPDVNGTLVGGASLTAEQFVP
IIEAGGRLA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacgcaagctcatcgccggcaattggaaaatgaacggttctttaggcatgttg
cacgaactggacgggatcgccaaggcaacctttaaccatccagaacttgatgttgtgatt
tgtccatccttcacgctgatagcgcccgctattgtgcggcaacccgatatgaccttcggg
gcgcaagattgccattatgatgaaagtggttcgcataccggctgtgtttcggcaccgatg
ctccgtgaggtcggtgcaagttatgtcatcgttggccatagcgaaagacgtattgaacag
aatgaaaccaatgaagagatccgagcaaaaacgacaacggccatagccaatggccttgtg
acgattgtttgtattggcgaatcccgtgctgcccacgcatccgggcaggctttgcctatc
attggggcgcagctggatggctgtattccgccagatgccaccagcgataatctagttgtt
gcctatgaacccatctgggctatcggaacggggaataccccaccgcctgaaagcattgcc
gaaatgcacgcctcgattcgtgaccgcttatgcttgttactaggaagcgaagggaagaag
gtccgcatcttatatggaggctctgttaccggcaaaaatgccgaagaattgatggccatt
ccagatgtcaatggaactctggtcggtggcgccagccttaccgcagaacaatttgttcct
atcattgaagctgggggacgtttggcctag

DBGET integrated database retrieval system