KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0824Help
Entry
ZZ6_0824          CDS       T02187                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00230  Purine metabolism
zmb01100  Metabolic pathways
Module
zmb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ZZ6_0824
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ZZ6_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_22 AAA_18 AAA_16 ABC_tran AAA_29 CPT RsgA_GTPase AAA_23
Motif
Other DBs
NCBI-ProteinID: AFN56718
Position
937563..938213
Genome map
AA seq 216 aa AA seqDB search
MPSANFRLARRGLLFVISSPSGAGKSTIARRILAEDDEIHLSVSVTTRPKRPGEVDGVDY
HFVDVPTFKKMVAENQLLEWAHVFDNRYGTPRAPVEEMLHKGQDVLFDIDWQGAQQLWQQ
ASGDTIRVYILPPSFEELERRLRGRGTDSEEVIQKRMARAASEISHWDGYDYVLINDDMD
ECVKQVKNILTVERIKRRRQIGLIGFTRKLLAPPED
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagctaattttcgactagcccgccgtggacttctttttgttatatcctcaccc
tcaggtgcaggtaagtccactatcgcccgtagaatactggccgaagatgatgaaattcat
ctgtcagtttctgttacaacgcgtcccaaacgaccaggggaagttgacggagtagattat
catttcgtcgatgtcccgacttttaaaaagatggtcgccgagaaccagcttttggaatgg
gcgcatgtttttgataatcgctatggtacgccccgcgcccctgttgaagaaatgcttcac
aaaggccaagatgtcctctttgatatcgactggcagggtgcgcaacagctctggcaacag
gctagcggcgatacgatacgcgtttatattcttcccccttcttttgaagaactggaacgc
cggttaagaggtcggggaaccgattccgaagaagttatccaaaaaagaatggcacgcgct
gcaagcgagataagtcattgggatggctatgattatgttttgatcaatgacgacatggat
gaatgtgtcaaacaggtgaaaaacattctgacggtcgaaagaattaaacgccgccgtcaa
attggccttattggctttactcgcaaattattggcaccacccgaagattaa

DBGET integrated database retrieval system