KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0879Help
Entry
ZZ6_0879          CDS       T02187                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00010  Glycolysis / Gluconeogenesis
zmb00052  Galactose metabolism
zmb00500  Starch and sucrose metabolism
zmb00520  Amino sugar and nucleotide sugar metabolism
zmb00521  Streptomycin biosynthesis
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01120  Microbial metabolism in diverse environments
zmb01130  Biosynthesis of antibiotics
zmb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZZ6_0879
   00052 Galactose metabolism
    ZZ6_0879
   00500 Starch and sucrose metabolism
    ZZ6_0879
   00520 Amino sugar and nucleotide sugar metabolism
    ZZ6_0879
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZZ6_0879
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ZZ6_0879
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ZZ6_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Hairpins
Motif
Other DBs
NCBI-ProteinID: AFN56772
Position
complement(994289..995263)
Genome map
AA seq 324 aa AA seqDB search
MEIVAIDIGGTHARFSIAEVSNGRVLSLGEETTFKTAEHASLQLAWERFGEKLGRPLPRA
AAIAWAGPVHGEVLKLTNNPWVLRPATLNEKLDIDTHVLINDFGAVAHAVAHMDSSYLDH
ICGPDEALPSDGVITILGPGTGLGVAHLLRTEGRYFVIETEGGHIDFAPLDRLEDKILAR
LRERFRRVSIERIISGPGLGNIYEALAAIEGVPFSLLDDIKLWQMALEGKDNLAEAALDR
FCLSLGAIAGDLALAQGATSVVIGGGVGLRIASHLPESGFRQRFVSKGRFERVMSKIPVK
LITYPQPGLLGAAAAYANKYSEVE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgcgattgacatcggtggaacgcatgcgcgtttctctattgcggaagta
agcaatggtcgggttctttctcttggagaagaaacgacttttaaaacggcagaacatgct
agcttgcagttagcttgggaacgtttcggtgaaaaactgggtcgtcctttgccacgtgcc
gcagctattgcatgggctggcccggttcatggtgaagttttaaaacttaccaataaccct
tgggtattaagaccagctactctgaatgaaaagctggacatcgatacgcatgttctgatc
aatgacttcggcgcggttgcccacgcggttgcgcatatggattcttcttatctggatcat
atttgtggtcctgatgaagcgcttcctagcgatggtgttatcactattcttggtcctgga
acgggcttgggtgttgcccatctgttgcgaaccgaaggccgttatttcgtcatcgaaact
gaaggcggtcatatcgactttgctccgcttgacagacttgaagacaaaattctggcacgt
ttacgtgaacgtttccgtcgcgtttctatcgaacgcattatttctggcccgggtcttggt
aatatctacgaagcactggctgccattgaaggcgttccattcagcttgctggatgatatt
aaattatggcagatggctttggaaggtaaagacaaccttgctgaagccgctttggatcgc
ttctgcttgagccttggcgctatcgctggtgatcttgctttggcacagggtgcaaccagt
gttgttattggcggtggtgtcggtcttcgtatcgcttcccatttgccggaatctggcttc
cgtcagcgctttgtttcaaaaggacgctttgaacgcgtcatgtccaagattccggttaag
ttgattacttatccgcagcctggactgttgggtgcggcagctgcctatgccaacaaatat
tctgaagttgaataa

DBGET integrated database retrieval system