KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0919Help
Entry
ZZ6_0919          CDS       T02187                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZZ6_0919
   00670 One carbon pool by folate
    ZZ6_0919
Enzymes [BR:zmb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ZZ6_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1050534..1051031)
Genome map
AA seq 165 aa AA seqDB search
MPSLSEIMLIFARAQNGVIGKDNTMPWHVSADLKHFKALTLGHPMIMGRRTFESLPGLLP
KRPHIVLTHNHHWQAKGAEAVCDLEEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELT
EIYRDYSGDTFVDLPDMNHFSLVRQEDFKAEDECPAFSFKSFLRK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccttctttatctgaaataatgcttatttttgcccgcgctcaaaatggcgtaattggc
aaggataacaccatgccttggcatgtttctgctgatttgaaacattttaaggccttaacg
cttggtcatccgatgattatggggcggcggacttttgagagtttgcccggcttgctgccg
aaaaggccacatattgttttgacccataatcatcattggcaggcgaagggtgccgaagcc
gtttgtgatttggaagaggctataaaagccgctcggaaatatagtagccaaattgcagtg
attggtggagccaatatttttcaacaattttgggataaagcggatcggatcgagttgacc
gaaatctatcgcgattattctggtgatacctttgtcgatttgcctgatatgaatcatttt
tctttggtgagacaagaggattttaaagcagaagatgaatgtccggcttttagtttcaaa
tcatttctaaggaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system