KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_0919Help
Entry
ZZ6_0919          CDS       T02187                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zmb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:zmb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1050534..1051031)
Genome map
AA seq 165 aa AA seqDB search
MPSLSEIMLIFARAQNGVIGKDNTMPWHVSADLKHFKALTLGHPMIMGRRTFESLPGLLP
KRPHIVLTHNHHWQAKGAEAVCDLEEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELT
EIYRDYSGDTFVDLPDMNHFSLVRQEDFKAEDECPAFSFKSFLRK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccttctttatctgaaataatgcttatttttgcccgcgctcaaaatggcgtaattggc
aaggataacaccatgccttggcatgtttctgctgatttgaaacattttaaggccttaacg
cttggtcatccgatgattatggggcggcggacttttgagagtttgcccggcttgctgccg
aaaaggccacatattgttttgacccataatcatcattggcaggcgaagggtgccgaagcc
gtttgtgatttggaagaggctataaaagccgctcggaaatatagtagccaaattgcagtg
attggtggagccaatatttttcaacaattttgggataaagcggatcggatcgagttgacc
gaaatctatcgcgattattctggtgatacctttgtcgatttgcctgatatgaatcatttt
tctttggtgagacaagaggattttaaagcagaagatgaatgtccggcttttagtttcaaa
tcatttctaaggaaataa

DBGET integrated database retrieval system