KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1004Help
Entry
ZZ6_1004          CDS       T02187                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZZ6_1004
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZZ6_1004
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ZZ6_1004
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ZZ6_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1147728..1148921
Genome map
AA seq 397 aa AA seqDB search
MVADLTSDISESQEQETETNSANNNGAVFRPENCPRLVIKIGSSLLVDQRGQVRRDWLQT
VAYDIAKLHQAGQQIIVVSSGAIALGARRLNLPRGGRASLEDAQASASVGQILLSQCWAE
LLGACSLDSSQILLTLDDLEDRRRYLNVSATLDRLLSLGVVPVINENDSIATAEIRFGDN
DRLAARIGQASHASGVILFSDVDGLYTANPMKDPNAKRIDRVEHIDNSTEAMASSDSASG
MGSGGMASKVEAARIATYSGVNLAITTGKRPSPLTMFLNDGAGTLFTADESASAHKTWLA
GRLTAHGQVYIDQGAVEALHDGNSLLPAGVCSIEGKFNRGDVVDILDQEHNLIARGLIEY
DSEDSAQITGKRSQEIADILGYEARTALIHRNHMVML
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctaacttctgatatttcagaatcccaagagcaagaaacagaaactaac
tctgccaataataacggcgcggttttccgaccggaaaactgcccgcgactggttataaaa
attggttcttctttgctcgttgaccaacgcggtcaagttcgtcgcgattggctgcaaact
gtcgcctatgacattgccaaattgcatcaagctggacagcaaatcattgttgtttcctca
ggcgctattgcccttggagccagacgcttgaacttgccacgcggtggacgggcttcctta
gaagatgctcaagcctcggcttctgtcggacaaattttgcttagccaatgctgggcagaa
ttgctgggtgcatgcagcttggattcatcccaaattctactgacactggatgatctggaa
gatcgccgccgctatctgaacgtctcggctacgcttgatcgcctgctttctcttggtgtc
gtgccagtcatcaatgaaaatgactcgattgcgaccgcagaaattcgttttggagataat
gaccgtctcgccgctcgcatcgggcaggccagccatgcctctggcgttatcctcttttca
gatgtggatggcctttacacggccaacccaatgaaagatcccaacgccaaacggattgat
cgggtcgaacatatcgacaatagcacagaagctatggctagcagtgattccgcttccggt
atgggttctggcggcatggcttccaaggtagaagcagcgcgtatcgctacctattccggt
gttaatctcgcgattacaacgggtaaacgcccttccccgctgacgatgtttttgaatgat
ggtgctggcacgctattcacagccgacgaaagcgcttcagctcataaaacatggctggcc
ggacgattaaccgctcatggtcaggtttatatcgatcaaggtgcggtcgaggcactccat
gatgggaacagcctgctccctgcgggcgtctgctccatagaaggcaaattcaaccgcggt
gacgtggtcgatatcctcgatcaagaacacaaccttattgcacggggtctgatcgaatat
gacagcgaagattctgcccaaatcacaggcaagcggtcgcaggaaattgctgatattcta
ggatatgaggccagaacagccctaatccatcgcaatcatatggttatgctatga

DBGET integrated database retrieval system