KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1118Help
Entry
ZZ6_1118          CDS       T02187                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ZZ6_1118
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ZZ6_1118
Enzymes [BR:zmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ZZ6_1118
Two-component system [BR:zmb02022]
 CheA family
  CheA-CheYBV
   ZZ6_1118
Bacterial motility proteins [BR:zmb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ZZ6_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275175..1276233)
Genome map
AA seq 352 aa AA seqDB search
MTVKVLIVDDSPTMRAILSMMISSDPEIEVVGKADCPSTARQMIKELNPDVMTLDIEMPG
MDGLDFLEKVMRLRPMPVIMVSALTAAGAEATLKAMELGAFDCFAKPALGFASDKSQSQM
LISMIKAAAKNGGHRPLSFRNRSASAQNAAPAPSSVASGYRPKPGSIIAIGASTGGVETL
LALLKDFPANCPPTLIVQHMPPLFTASFANRLDRMCPPKVSEAKTGDPLTPGHIYIAPGG
ERHLEFQNAAHGPRCLLVSDEPMSGHRPSVDRLFFSVAKNCGRRAIGIILTGMGQDGAMG
LKAMRDTGSFTIGQDEESCVVYGMPAAAYRMGAVESQLPLSRIAAKALEACA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcaaagtacttatcgtcgatgactcgccaacaatgcgtgccatcctatccatg
atgatttcgtcagatccagaaatcgaagtcgtcggcaaggcagactgtccctctacagcc
cgccagatgattaaagaactcaatcccgatgtcatgacgctggatattgaaatgccgggc
atggatggattggattttcttgaaaaggtaatgcggctgcgtccgatgcccgtcatcatg
gtctcggccttaaccgcggcaggtgccgaagccaccttaaaggccatggaattaggtgcc
tttgactgctttgccaaacccgcgctcggctttgcctctgataaaagtcaaagccagatg
ttaatcagcatgatcaaggccgctgccaaaaacggaggccatcgcccactttctttccgc
aaccgttcagcctctgcccaaaatgcagcgcctgctccatcaagcgtggcttccggctat
cgtccgaaaccgggcagcatcattgctatcggtgcttcaacgggcggcgtcgaaacgctg
ttggctttgctgaaagattttccggctaattgcccgccgactttgatcgtgcagcatatg
ccccccttattcacagcgagctttgcgaaccgtcttgatcgaatgtgtcctcccaaggtg
tccgaagccaaaaccggtgaccctttgacaccggggcatatttacatcgctccgggtggg
gaacgccatcttgaatttcaaaatgctgcccatggaccgcgctgtctcttggtctccgat
gagccgatgtcgggtcatcgcccttcagtcgatagattattcttctcggttgccaaaaat
tgcggtcgtcgggcaatcggtattattttgaccggcatggggcaagatggtgcgatggga
ctgaaagccatgcgcgatacaggttcctttaccattggacaggatgaagaaagctgcgtt
gtttacggaatgcccgctgcggcttatcgtatgggcgctgttgaaagccaactgccctta
tcccgtattgccgccaaagcgttggaggcctgcgcctaa

DBGET integrated database retrieval system