KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1248Help
Entry
ZZ6_1248          CDS       T02187                                 

Definition
uroporphyrinogen-III synthase-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZZ6_1248
Enzymes [BR:zmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ZZ6_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1424166..1424894
Genome map
AA seq 242 aa AA seqDB search
MLKEWQLNNRVQDKLLILRPEPGATATAKRAEKVGWQVIKTPLATAISVPWSINESLSFD
AVMVTSAQAIYHGGSELDKLKDYPLYVVGKATEVAARQAGFQHIVTAEGNGASVLCCLER
DKRMRILRLCGEIYKNYDYKNFSRKENTQFFIKILYRMQNIASLPIEACQALVENAIVLL
HSSCFAEQFRLLLTKTDINPDKVQIAVISPAVAEQIGKEWRAMAIAEYPDDTSLLKAAAS
LK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagaatggcaattaaataatcgtgttcaagataaattattgattttacgcccc
gagccgggggcaaccgccacagccaagcgtgcagaaaaagtaggttggcaagtaataaaa
acgcctcttgcaacggctatatccgtaccttggtcaataaatgaatctctatcttttgat
gcggttatggtaacgagtgcccaagctatttatcacggaggaagtgaactggataaatta
aaagactatcctctttacgtggttggcaaggctactgaggtggcagcacgtcaggcaggg
tttcagcatattgtaacggccgaaggtaatggcgcatctgtactttgttgtcttgaacgg
gacaaaagaatgcggatattaaggctctgcggtgaaatttacaaaaattatgactataaa
aatttttctcggaaagaaaacactcaattctttataaaaattctttatagaatgcaaaat
attgccagtttaccgatagaagcctgtcaggcattagtagaaaatgccatagtcttatta
cactcttcttgttttgcagagcaatttcgtcttttgcttacgaaaacggatatcaatcca
gacaaagttcagattgctgttattagcccagcagtagcagaacaaattggaaaagagtgg
cgggcaatggcaatagctgaatatcctgatgacacatctttgttaaaggcggcagctagc
ttgaaatga

DBGET integrated database retrieval system