KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1258Help
Entry
ZZ6_1258          CDS       T02187                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZZ6_1258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZZ6_1258
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ZZ6_1258
Enzymes [BR:zmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ZZ6_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434077..1435474
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPENWPAFSREDIAALAGLSYVDTAVAVMR
PFVSGVLDDQALKNLCEAAYGQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLSEEKGQDLTIVGATSGDTGSAAISAVAGRAGVQIVMLHPNGRVSEVQRRQMTT
VLDKNVHNVAIDGSFDDAQAIVKAMFNDSDFRKRHRLGAVNSINWARLMAQIVYYFYAAV
RLGAPDRKVAFSVPTGNFGDVFAGYAAKKMGLPVEKLIVATNINDILYRALSAGDYSVGN
VTPTDAPSMDIQISSNFERLLFDLHGRDAASLAATMAQFEQSRAIQISDAMRQQAATIFS
SKRIDPDEMAATMRWASDKAGQVIDPHTAIGLAAARETNLPKDVPVVTLATAHPAKFPDA
VSRITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDAGFQL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaaggggcgcggcagccgcgcaggattttaagggggttacctta
accgggcttgcctcggatggtggtctctatgtgccagaaaattggccagccttcagccgc
gaggatatcgctgcattagcaggattgtcctatgtcgatacggctgttgcggttatgagg
ccatttgtcagcggtgtgctcgacgatcaggcattaaaaaatctgtgcgaagccgcttat
ggtcagttcaaccatgcagctgttacgccgttggttcagttagatgaacggcatttcttg
ctggaattatttcatggcccgaccttggctttcaaggatgttgctttacaacttctgggt
catttatttgaaaaattcctttccgaagaaaaaggacaggatctgacaatcgtcggagcg
acctccggtgatactggatcagcggctatatctgctgttgctggacgagctggcgtgcaa
attgtgatgttgcatcccaacggtcgggtttccgaagttcaacgtcgccaaatgacgacg
gttctcgacaagaatgtccataatgtcgcgattgacggtagctttgatgatgcacaggct
attgtcaaagccatgttcaacgatagcgactttagaaaacgtcatcgcctaggcgctgtt
aattcgattaactgggcccgcttgatggctcagatcgtttattacttctatgcggctgtt
cgtcttggtgcacctgatcggaaagtagctttttctgttcctaccggtaactttggtgat
gtttttgcgggttatgctgccaaaaaaatggggctccctgtcgaaaaattgatcgttgcg
actaacatcaatgatatcctttatcgggcattatcagccggtgattattctgtcggtaat
gtaaccccgactgatgcgccgtcgatggatatccaaatcagttccaattttgaacgcctg
ctttttgaccttcatggtcgggatgcagcttctttggcggcaacaatggcgcaatttgaa
cagagtcgtgctatccagatttctgatgcaatgcgccagcaagctgcaacgatattcagc
agcaaacgcattgatcccgatgaaatggctgcaaccatgcgttgggcttccgataaagca
ggacaggttattgaccctcatacggctattggtttggcggccgcccgtgaaacgaatctt
ccaaaagacgttccggtcgttaccttggcaactgcccatccggcaaaattccctgatgct
gtttcccgtattacgggtaaaaatgcgcctctgccgcatcgtttggctgatctttacagc
cgtgaagaacgctatgttgaactgcctgcctcacgtcagacaattcaggcttatattgat
gccggattccagctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system