KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1357Help
Entry
ZZ6_1357          CDS       T02187                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ZZ6_1357
   00052 Galactose metabolism
    ZZ6_1357
   00500 Starch and sucrose metabolism
    ZZ6_1357
   00520 Amino sugar and nucleotide sugar metabolism
    ZZ6_1357
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ZZ6_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544165..1545031
Genome map
AA seq 288 aa AA seqDB search
MKPVRKAIFPVAGQGTRFLPATKAMPKEMLPVVDRPLIQYAVDEARAAGIEELIFVTGRG
KQAIEDYFDIAYELEASLTAKGKTGMLDLLEGTRVAPGRACFIRQQEPLGLGHAVWCARD
LIGDEPFAVLLPDELLWNPEKPSLVQLVETYNQKGGNVVTVMEVPEEHTHRYGIVDPGKT
DGEVTEVKGLIEKPEKAPSRLAMTGRYILQPDIMPLLAQDNRGVGGEIQLTDSMAQLIGK
QPFHACRFGGIRHDCGDKAGFIQANVALALERPDIGPAVREYLHRQNF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtccgtaaagcaatttttcctgttgccggccaaggcacccgctttttgcca
gcgaccaaggctatgcccaaggaaatgctgccggtcgttgaccgccctttgattcaatat
gctgtcgatgaagcacgggcagccggcattgaagaactgatctttgttaccggacgtggc
aagcaggctatcgaagattattttgatattgcctatgaattagaggcctcactgacggcc
aagggcaaaaccggaatgctggatttgctggaagggacgcgggtggctccgggtcgtgcc
tgttttatccggcaacaggaaccgttaggtttgggacatgctgtctggtgcgcccgtgat
ttgatcggcgatgagccttttgcggttcttttgcccgatgaattactttggaatcctgaa
aaacccagtctggtgcaattggttgagacctataaccagaaagggggtaacgtcgtcacc
gtgatggaagtccccgaagagcatacccatcgttatggtatcgtcgaccccggtaaaact
gacggcgaggttaccgaggttaaaggtctgattgaaaaaccggaaaaagccccttcgcgg
ttagccatgacgggacgttatattctccaaccggatattatgcctttattggcacaggat
aatcgcggtgtcggtggtgaaatccagttgacggattcgatggcacagctgatcgggaag
caaccttttcacgcctgtcgctttggcggtattcgccatgactgcggtgataaggccgga
tttattcaggcaaatgttgcgttagccttggaaagacctgatataggccctgcggttaga
gaatatctacatcgccaaaatttttaa

DBGET integrated database retrieval system