KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1393Help
Entry
ZZ6_1393          CDS       T02187                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZZ6_1393
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZZ6_1393
Enzymes [BR:zmb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ZZ6_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583017..1584297
Genome map
AA seq 426 aa AA seqDB search
MDRIKIRGGHRLKGRIPVSGAKNAVLALMPASLLTSDSLTLINLPRLADVDSCCHLLNEL
GVSTMVARSKGDHPGREITLTADTIASTVAPYDIVRKMRASILVLGPLLAREGEATVSLP
GGCAIGNRPIDLHLRALEALGAEIELTAGYVRARAPDGGLRGGIISFPVVSVGATENAIM
AAVLARGETVINNAAREPEIVDLCQCLMAMGAKIDGVGNSRLVIHGCDRLHGATHVVMPD
RIEAGSYACAAAITGGDVLLQGARSADMAEVLVELKESGLNISVEEDGIRVQADAPLKSL
TLSTAPFPGFPTDMQAQFMAMLALAQGTSVLTETIFENRYMHVPELVRMGADIQVKGRVA
VVKGVSGLVGAEVMATDLRASMSLIIAALAAEGETQVHRVYHLDRGYERLEEKLSAVGAD
IERVGG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtatcaaaattcgcggtggccatcgcttgaaaggccgaattcctgtttccggc
gctaaaaatgccgttttggcgttaatgcctgccagtcttttaaccagtgactctttaacg
cttatcaatcttccgcgccttgcggatgtggatagctgttgccatttgttgaatgaatta
ggcgtttcaacaatggtcgctcggagtaagggagatcatcccgggcgtgaaattacgctg
acggcggatactatcgcttcgacggttgccccttatgatatcgttcgtaagatgcgcgct
tcgattctcgttttggggcctttattggcaagagaaggcgaagcaacggtttctctccca
ggcggctgtgccatcggtaaccgtccgattgatttacatcttcgggctttggaagcgttg
ggtgccgaaattgagttgacggcgggatatgttcgggcaagagcgccggatggcggtctt
cgaggcggtatcatcagctttccggtggtttcggttggcgccactgaaaatgcgattatg
gcagcggtgttagcacgcggtgaaaccgtgattaataatgccgcccgcgaacctgaaatt
gtcgatctttgccaatgtcttatggccatgggtgctaaaattgacggtgtcggcaatagc
cgccttgtcattcatggttgtgaccgcctgcatggagcgacccatgtggttatgcctgac
cgtatcgaggcaggtagttatgcctgtgccgcagctatcaccggtggcgatgtcttgttg
cagggtgccagatcagcggatatggccgaagttttggtcgaactgaaagaaagcggcctc
aatatttcggtggaagaagacggtatccgcgtccaggccgatgccccgttaaagagctta
actttatcgacagcgcctttccccggttttccgaccgatatgcaggcacaatttatggcg
atgttggctttagctcagggtaccagtgttctgactgaaaccatctttgaaaatcgctat
atgcatgtaccagaactcgtcaggatgggtgccgatattcaggtgaaaggacgggtcgcc
gttgtaaaaggtgtctcaggattggtcggtgccgaagtgatggcgaccgatttgcgggct
tcgatgagcttgattatcgcggctctggctgccgaaggcgaaacgcaggttcaccgcgtt
tatcaccttgatcgtggctatgaacgtttagaagaaaaactatctgctgtcggtgctgat
atcgaacgtgtcggcggataa

DBGET integrated database retrieval system