KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1468Help
Entry
ZZ6_1468          CDS       T02187                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZZ6_1468
Enzymes [BR:zmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ZZ6_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1662149..1662700
Genome map
AA seq 183 aa AA seqDB search
MLYAIALGSNRWHGRYGRPSAVIEAAIAALEKEKIAIHSRAPIFETAAVGSGGRRYANSA
IIIKTDLQPLALLAICKKIEQAFGRRKGKRWGARVLDLDIVLWEKGRWPRKIQPRLRYKP
ALAAGQPPALWPKLHIPHLEISRRDFVLKPLLSIAGNWPVFQKNGFFTVKQLYFRYKYLT
SKQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgctttacgctatcgcactaggctctaatcgttggcatggtcggtatggtcggccatct
gcggtcatcgaggcggcgattgctgcattggaaaaagaaaagattgcgatccattctcgc
gctccgatttttgaaacggcggcggtcgggtctggtggacggcgttatgctaattccgcg
attattattaaaacagatttgcaaccgcttgcgttgctggcgatttgtaaaaaaatagaa
caggctttcggccgacgaaaaggaaaaagatggggggcgagggtgctcgatcttgatatt
gtcttatgggaaaaaggccgctggccacgaaaaatacagccccgccttcgctacaagcct
gccttggctgcaggacaaccaccggctttatggccaaaacttcatattccccatcttgag
atcagtcgtcgcgattttgtgctgaaaccgctgctttcgatcgccggaaattggcctgtt
tttcaaaaaaatggattttttacggtaaaacagctatattttcgctataagtacttgacc
tccaagcaataa

DBGET integrated database retrieval system