KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1548Help
Entry
ZZ6_1548          CDS       T02187                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00340  Histidine metabolism
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ZZ6_1548
Enzymes [BR:zmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ZZ6_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh EF-hand_6 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AFN57410
Position
complement(1763890..1765182)
Genome map
AA seq 430 aa AA seqDB search
MLLKLDSRKADFEAGFTRLVDERRESEGDVSRDVSAIIADVKKRGDVAIAELTQKFDRHD
LNKGGWQLTQEEIKKACDSLPSELMDALKLAATRIRYCHENQLPESSEMTDAAGVRMGVR
WQAVEAAGLYVPGGRAAYCSSVLMNAVPAKVAGVKRLVMVTPTPDGFVNPAVIAAAVISE
VDEIWKIGGAQAVAALALGTEKIKPVDVVVGPGNAWVAEAKRQLYGQVGIDMVAGPSEIV
VVADKDNDPEWLAADLLSQAEHDPTSQSILISDSEDLIEKTIEAVGRRLEKLETQKVARE
SWDKHGATILVQSLDEAPALVDRLAPEHLELAVADPDALFANVHHSGSVFLGRYTPEAIG
DYVGGPNHVLPTGRRARFSSGLSVIDFMKRTTYLNCSQEALSKIGPAAVTLAKAEGLPAH
AESVISRLNK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttaaattagatagccgtaaggctgatttcgaagcgggttttactcggttagtt
gatgaaagacgggaaagcgaaggcgatgtttcccgtgatgtctcggccattattgccgat
gtcaaaaaacggggtgatgttgctattgccgaattgacccagaaattcgatcgtcatgat
ctgaataagggtggatggcagctgacccaagaagaaatcaagaaggcttgtgattctctg
ccttcggaattgatggacgctttaaaactggccgcgacccgtattcgttactgccacgaa
aaccagctgcctgaaagcagcgagatgaccgatgccgctggcgttcgtatgggtgttcgt
tggcaggccgttgaagccgccggtctttatgttccgggtggacgtgccgcttattgttct
tctgttttgatgaacgccgtgccagccaaggtcgctggtgtgaagcgtctggttatggtg
accccaaccccagatggttttgtcaatccggccgtgattgccgctgctgtgatttccgaa
gtcgatgaaatctggaaaattggtggcgcgcaggctgtcgcggctttggcgttgggaact
gaaaagatcaaaccggttgatgtcgttgtcggccccggtaacgcttgggtggctgaagct
aagcgtcagctttacggtcaggtcggcattgatatggtggcaggcccgtctgaaatcgtg
gtggttgccgataaggacaacgatcccgaatggttggcggccgatcttttaagtcaggct
gaacatgacccgaccagccagtcaattttgatttctgattccgaagatttgatcgaaaaa
acgatcgaagccgttggaagacgactggaaaaactggaaacccaaaaggttgcccgcgaa
agctgggacaaacacggcgccactattttggtgcagtctttggatgaagcccctgctttg
gttgaccgtctggcaccggaacatcttgaattggctgtggccgatcctgatgctttattt
gccaatgtgcaccactctggttcggtcttccttggccgttatacgccggaagccatcggc
gattatgttggtggcccgaaccatgttttgccaaccggtcgtcgtgcgcgcttctcttct
ggattgtcggttatcgactttatgaagcgcaccacttatcttaattgctcgcaagaggct
ttaagtaagattggccctgcggccgtgacgttggcaaaggctgaaggcctgcctgctcac
gctgaatctgtgatatcaaggcttaataaataa

DBGET integrated database retrieval system