KEGG   Zymomonas mobilis subsp. mobilis ATCC 29191: ZZ6_1613Help
Entry
ZZ6_1613          CDS       T02187                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
zmb  Zymomonas mobilis subsp. mobilis ATCC 29191
Pathway
zmb00020  Citrate cycle (TCA cycle)
zmb00640  Propanoate metabolism
zmb00660  C5-Branched dibasic acid metabolism
zmb01100  Metabolic pathways
zmb01110  Biosynthesis of secondary metabolites
zmb01120  Microbial metabolism in diverse environments
zmb01130  Biosynthesis of antibiotics
zmb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZZ6_1613
   00640 Propanoate metabolism
    ZZ6_1613
   00660 C5-Branched dibasic acid metabolism
    ZZ6_1613
Enzymes [BR:zmb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ZZ6_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFN57472
Position
1841334..1842530
Genome map
AA seq 398 aa AA seqDB search
MNIYEYQAMALLNERGVSVVPGYMAANVEEAVKAAEQLSSPPYVIKSQILAGGRGKGYFR
ESPKEGGGVRLVSDIAAVKKQAESMLGRHLVTAQTDDQGIPVEKLLITEAVSIAREFYLS
LLVDRQTGRVTFVASPEGGMDIETVAKEKPEAIHRIAIDPATGFQPHHGRMIGFALGLSG
DVFKQGIKLAASLYKAFTTSDMSLLEINPLVETNDGKLLPVDAKISFDDNALFRHPDIAA
LGEAGASDLLEQEARQAGLSYIKLDGSIGCMVNGAGLAMGTMDIIQLHGEMPANFLDVGG
GASKEKVAAAFRIILSDPSVKGILVNIFGGIMRCDILAEGIIAAARELDITVPLVVRLEG
NNVNEGKAALVSSGLPIITASDLGDAAQKIVAAIRQTA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatatacgaatatcaggcgatggctcttttgaatgaacggggtgtctcggttgtc
cccggttatatggccgccaatgtagaagaagccgtcaaagcggcagaacagctttcctct
cctccttatgtcatcaaatcccagattctagccggtggtcgcggcaagggttatttccgc
gaatctccgaaagagggcggtggcgtccgtttggtctctgatattgccgctgtcaaaaaa
caggcagaatcaatgctcggtcggcatttggtcactgcccagacggatgatcagggtatt
ccggttgaaaaactgttgattaccgaagctgtctctattgctcgcgaattttatctttct
ctgttggttgatcgccagacggggcgggtgacctttgtcgcttcacccgaaggcggtatg
gatatcgaaaccgttgccaaagaaaaaccggaagctattcaccgtatcgctattgatcca
gcaacaggcttccagccccatcatggccgaatgatcggttttgcactgggcttgtccggt
gatgtttttaaacaaggcatcaaattagccgcgagcttatataaagcctttacgacttcg
gatatgagtctgcttgaaatcaaccccttggtcgaaaccaatgacggtaaacttttaccc
gttgatgccaaaatcagctttgacgacaatgcgctattccgccaccctgatatcgcggcc
ttaggggaagcaggtgcctccgatcttttggaacaagaagcccgtcaggccggtttatcc
tatatcaaactggatggtagcatcggctgcatggtcaatggtgcagggcttgctatggga
acgatggatataatccagcttcatggcgagatgcctgccaacttcttagatgtcggtggc
ggtgccagcaaagaaaaagtggctgccgcttttcggattattctttctgacccatccgtc
aaaggtattctggtcaatatcttcggtggaattatgcgttgcgatatcctcgcagaaggc
attatcgccgccgctcgtgaactggatataaccgtgcctttggtcgtccggttagaaggc
aacaatgttaacgaaggtaaggccgctcttgtctcttcaggattgcccattattacagcc
agtgatctcggcgatgccgctcaaaaaatcgtagccgctatccggcagactgcctga

DBGET integrated database retrieval system