KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0041Help
Entry
Zmob_0041         CDS       T01875                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00230  Purine metabolism
zmm00240  Pyrimidine metabolism
zmm01100  Metabolic pathways
zmm03030  DNA replication
zmm03430  Mismatch repair
zmm03440  Homologous recombination
Module
zmm_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Zmob_0041
   00240 Pyrimidine metabolism
    Zmob_0041
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Zmob_0041
   03430 Mismatch repair
    Zmob_0041
   03440 Homologous recombination
    Zmob_0041
Enzymes [BR:zmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Zmob_0041
DNA replication proteins [BR:zmm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Zmob_0041
DNA repair and recombination proteins [BR:zmm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Zmob_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi Malectin_like
Motif
Other DBs
NCBI-ProteinID: AEH61898
UniProt: A0A0H3FVR7
Position
48858..49304
Genome map
AA seq 148 aa AA seqDB search
MVARVDFYHLLSAKLENILPRIAEKTLSSDKKLLVVVPDDQQARYWDDYLWRYEDTSFLP
HGRVGGGDEAEHPVLISTAMEAVNQASYIALTDGLWRAEALNFERVFYFFDEIAVQQARQ
AWRSLKNIDGECHYWKQDEQAGQWKAIA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggtagcacgggttgatttttatcatttgctttcggcaaagctggaaaatattctgccg
cgtattgcggaaaaaacattgtccagcgataaaaaattgctggttgtcgtccccgatgac
cagcaagcccgctactgggatgactatctttggcgttatgaagataccagctttctccct
catggcagggtaggcggtggcgatgaagccgaacatcccgttctaatctcgacggcaatg
gaggcggtcaatcaggcaagctatattgcgctaacagacggattatggcgagcagaggcc
ttaaatttcgagagagtattttattttttcgatgaaatcgcggtgcaacaagctcggcaa
gcttggcgttctttgaaaaatatcgacggtgaatgccattactggaaacaggatgaacag
gcggggcagtggaaggccatagcctaa

DBGET integrated database retrieval system