KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0041Help
Entry
Zmob_0041         CDS       T01875                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Zmob_0041
   00240 Pyrimidine metabolism
    Zmob_0041
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Zmob_0041
   03430 Mismatch repair
    Zmob_0041
   03440 Homologous recombination
    Zmob_0041
Enzymes [BR:zmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Zmob_0041
DNA replication proteins [BR:zmm03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Zmob_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48858..49304
Genome map
AA seq 148 aa AA seqDB search
MVARVDFYHLLSAKLENILPRIAEKTLSSDKKLLVVVPDDQQARYWDDYLWRYEDTSFLP
HGRVGGGDEAEHPVLISTAMEAVNQASYIALTDGLWRAEALNFERVFYFFDEIAVQQARQ
AWRSLKNIDGECHYWKQDEQAGQWKAIA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggtagcacgggttgatttttatcatttgctttcggcaaagctggaaaatattctgccg
cgtattgcggaaaaaacattgtccagcgataaaaaattgctggttgtcgtccccgatgac
cagcaagcccgctactgggatgactatctttggcgttatgaagataccagctttctccct
catggcagggtaggcggtggcgatgaagccgaacatcccgttctaatctcgacggcaatg
gaggcggtcaatcaggcaagctatattgcgctaacagacggattatggcgagcagaggcc
ttaaatttcgagagagtattttattttttcgatgaaatcgcggtgcaacaagctcggcaa
gcttggcgttctttgaaaaatatcgacggtgaatgccattactggaaacaggatgaacag
gcggggcagtggaaggccatagcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system