KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0100Help
Entry
Zmob_0100         CDS       T01875                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:zmm01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zmm00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:zmm00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:zmm00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:zmm00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108098..109111
Genome map
AA seq 337 aa AA seqDB search
MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtcataactaaagatcatacgatcgaagtgaaagacaccaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccacgtgaaaaacggggattttggcgatgaaaccggcagaattactggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgcgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagcgggaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggcgctatggcagaagaa
tgcattgtcgttgccgattactcggtcaaagtgccagatggtcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccgggacaatggctggctatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagctgggcgcagatatggtcatcaatccgaaaaatgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcgacggtggtgacggctgttgccaaatcc
gcctttaactcggctgttgaagctatccgcgcgggtggccgtgttgtcgctgttggtctg
cctcctgaaaaaatggatttgagcattcctcgtttggtgcttgacggtatcgaagtccta
ggttccttggtcggaacgcgggaagatttgaaagaagccttccagtttgcagccgaaggt
aaggtcaaaccgaaagtcaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggtaaattcacaggccgtatggttgttgattttacccatcactag

DBGET integrated database retrieval system