KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0100Help
Entry
Zmob_0100         CDS       T01875                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Zmob_0100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zmob_0100
  Lipid metabolism
   00071 Fatty acid degradation
    Zmob_0100
  Amino acid metabolism
   00350 Tyrosine metabolism
    Zmob_0100
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Zmob_0100
   00626 Naphthalene degradation
    Zmob_0100
Enzymes [BR:zmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Zmob_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108098..109111
Genome map
AA seq 337 aa AA seqDB search
MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtcataactaaagatcatacgatcgaagtgaaagacaccaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccacgtgaaaaacggggattttggcgatgaaaccggcagaattactggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgcgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagcgggaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggcgctatggcagaagaa
tgcattgtcgttgccgattactcggtcaaagtgccagatggtcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccgggacaatggctggctatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagctgggcgcagatatggtcatcaatccgaaaaatgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcgacggtggtgacggctgttgccaaatcc
gcctttaactcggctgttgaagctatccgcgcgggtggccgtgttgtcgctgttggtctg
cctcctgaaaaaatggatttgagcattcctcgtttggtgcttgacggtatcgaagtccta
ggttccttggtcggaacgcgggaagatttgaaagaagccttccagtttgcagccgaaggt
aaggtcaaaccgaaagtcaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggtaaattcacaggccgtatggttgttgattttacccatcactag

DBGET integrated database retrieval system