KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0177Help
Entry
Zmob_0177         CDS       T01875                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Zmob_0177
Enzymes [BR:zmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Zmob_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
199024..200190
Genome map
AA seq 388 aa AA seqDB search
MSQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIA
DPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTV
ALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPF
RTTSLAEMATVTPERAVQHPNWSMGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILV
HPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAP
DYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPA
TPSSLEDVFAIDNEARIQAAALMESLPA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagccaagaacagtcactgttttaggggcgaccggatccattggtcattcaaca
ctggatttaatcgaacggaatttagatcggtatcaggtcatcgctttgaccgccaaccgc
aatgtcaaagatctggccgatgcggcgaaaagaacgaatgccaagcgggcggttatcgct
gacccgtcgctttataatgatctgaaagaggctttggccggaagctctgttgaggcagcc
gcgggtgctgatgccttggtcgaagccgccatgatgggtgccgattggacaatggcagcc
attatcggttgcgccggtctaaaagcgacgcttgcagctattcgcaagggcaaaacggtc
gctttggccaacaaggaatccttagtttcagctggcggattgatgatcgatgccgtgcgg
gaacatggcacgacgcttctccccgtcgattccgagcataacgctattttccaatgcttc
ccgcatcataatcgcgactatgttcgccggattattattacggccagcggaggtcccttc
agaacaacgtctcttgccgaaatggcaacggtcacgccagaacgcgcggttcagcatccc
aactggtcaatgggtgccaaaatttctatcgattctgctacaatgatgaataaagggctt
gaattgatagaagcctttcatctcttccagattccattagaaaaatttgaaattttggtt
catcctcagtcagttattcactccatggtggaatatttggatggttctatccttgcccag
atcggtagtcctgatatgagaacaccgatcggtcatactttggcttggccaaagcggatg
gaaactccagccgaatcgttggattttaccaaattgcgccagatggattttgaggcaccg
gattatgaacgttttccggcgttaactttggcaatggaatccatcaaatcaggtggggct
cgtcccgctgtaatgaatgccgctaatgaaatcgctgtggcggccttccttgataagaaa
atcggttttcttgatatcgctaaaattgtcgagaaaacattagatcattatacacccgca
accccgtcttctttggaagatgtctttgcgatcgacaatgaagcgcggatacaagccgct
gctttaatggagagtttgcccgcgtga

DBGET integrated database retrieval system