KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0234Help
Entry
Zmob_0234         CDS       T01875                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(271540..272559)
Genome map
AA seq 339 aa AA seqDB search
MTYSRRFILSTLVSVPLLVACRKGKAAEADNWTLFKSRFFKDGRISDSGNGNISHSEGQG
YGMIQAEAAHDKATFDALWQWTKTHLMRPDMALFAWRFDPSQSNPVSDQNNATDGDILIA
WALLRAEKRWPKNGYGQDSEAIRKSIGKKLVLSGGGETILLPGLQGFTGTDYVILNFSYY
IWPALKAFNEADNGAWHNVIESGKKLLAKAKFGLPQLPTDWVAFKNNGNLEPAADKQPYF
GFDAVRIPLYLIWGGEDALAAPFAIYWNSYLSHNQPVPAWVDVNSQAIAPYPLSKGGMAI
LDLAMNKPITAKIADQDDYYSSALLALSEIAAKERPHNR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacctatagtcgtcgttttatcctttccactttggtaagcgtccctttgctggtagcc
tgtcggaagggtaaagcggccgaagctgataattggacattattcaagagtcgctttttt
aaagatggccggatttcagatagcggtaatggaaatatcagtcatagcgaaggacagggc
tatggcatgatacaagcagaagctgcccatgataaagcgacctttgatgctttgtggcag
tggacaaaaacgcatctcatgcggcctgatatggcactttttgcatggcgctttgatccg
tcccaatctaatccggtatcagaccagaataatgcgacggatggcgatattctgatcgca
tgggctttattgcgtgcagaaaagcgttggccaaagaacggttacgggcaggattccgaa
gcaattagaaaatctatcggtaagaagctggttctttctggtggtggtgaaaccattctg
cttcccggcttacagggttttaccggcactgattatgttattctgaatttctcttattat
atatggcctgcgttaaaagcctttaatgaggctgataacggggcttggcataatgttatt
gaaagcgggaaaaaattattggcaaaggctaaattcggtttgccacagttgcccactgat
tgggtcgctttcaaaaataacggcaatcttgaacccgccgccgacaagcaaccttatttc
ggttttgatgccgttagaatcccgctctatctgatttgggggggagaagatgccttggca
gctccctttgctatttattggaatagctatctttcccataatcagcccgttccggcatgg
gtcgatgtgaatagccaagctattgcgccttatcctttatcaaaaggaggtatggctatt
cttgatctggcaatgaataaacccattaccgcgaaaattgccgatcaggatgattattat
tcttcagctttattggctctttccgaaattgctgcgaaagaaagaccgcataaccgctaa

DBGET integrated database retrieval system