KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0418Help
Entry
Zmob_0418         CDS       T01875                                 

Definition
putative CheA signal transduction histidine kinase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:zmm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:zmm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480717..482390
Genome map
AA seq 557 aa AA seqDB search
MTQPEKKLFTLWQAQKKTIENDLKACQAGIYDSKCLLRLEMAIKELNNQASGNNETALVQ
LTFLLAQLIEAIRKDRLALNLFLIDLIQRSFDTIENDILAITSKQIPVDQTQIEEELQKT
IAHSSQYAIKKVGHEITIDKPEVILSKNALVADDPVTRIHQNATDETLHVEGSLEPHIPV
NPEKLDNLFDIFHEMLSIRSELSLTHGLSDEKAGRVNALEKLDQLIQSANNYAMALQTQT
IEPLFKQVIDIIKQRCGNNHKNIIFSVIGSEIKIDKRIVIDLGKALLELVDNAAFHGIEE
SETRQEMGKPREGHIRLEARYHASRLKIIIADDGRGILWKKLVKIAEQYGIIADKDAPDG
KADETQSFESHASHHGKGGFATVKDIVQSLKGEIRIYAPPRLGTRVTMLLPLNQTMVEGL
ITTVKDQSYILPISDIIESIAVNAEDIHWVDERQSMIQLRDQWFPAIALSALLGEENFTQ
DSFKTGRKILIRIDPTIHQPEVMIIVDALESQRQVLVQSLEKNFQAVHGISGVAFLQEGQ
TALVIDIDSLLNPHKYS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccgaaaaaaaactgtttactttatggcaagcccaaaaaaaaacgatcgaa
aatgatctaaaggcctgtcaggccggtatctatgacagcaaatgcctgctccgtctggaa
atggcgataaaagaactgaataatcaggcctctggcaataatgaaacagcgttagttcag
ttaacttttttactagcgcaactgatagaagcgatccgcaaagatcgcttggctttaaat
ctgttcttaattgatcttatccagcgtagttttgatacgatcgaaaatgacattctggcc
attacatcaaaacagattccggttgaccagacccagattgaagaagaattacaaaagaca
atcgcccattcttctcaatatgcgattaaaaaagtcggtcatgaaatcactatagacaag
ccagaagtcattttatccaaaaacgctctggtggccgatgatcccgtaacgcgtattcat
caaaatgccacggatgaaacgcttcacgttgaaggcagtcttgaaccgcatattccagtt
aatcctgaaaaactggataacctattcgatatattccacgaaatgctgagcattcgttca
gaattaagtctcactcatggcctttcagatgaaaaagctggtcgggtcaatgcgctcgaa
aaattggatcaactgatccaatctgccaataattatgctatggcgctccaaactcagact
atcgagccgctttttaaacaagtcattgatatcattaagcaaagatgcggtaataatcac
aaaaatattattttttcagttatcggatctgaaatcaaaatcgacaaacggatcgtcatt
gatcttggcaaggctttacttgaacttgtcgataatgcggcctttcacggcattgaagaa
agcgaaacgcgtcaggaaatgggtaaacctcgcgaaggtcatattcgcttggaagcccgc
tatcatgccagccgcttaaagatcattatcgccgatgatggccgtggcattctttggaaa
aaactggtcaaaattgccgaacaatacggcataattgcagataaagatgctccagatggg
aaagcagacgaaacgcaatcttttgaaagccatgcctcgcatcatggaaaaggcggcttt
gcgaccgtcaaagacattgttcagtcattaaagggagaaatccgcatttatgctcctccc
cgtttaggcacgcgggtcacgatgcttctaccccttaatcaaacgatggttgaaggcctg
attaccaccgtcaaagatcaaagctatatcctgcctatctccgatatcatcgaaagcatc
gcggtcaacgcagaagatattcattgggtcgatgaaagacagtcaatgatccaactacgg
gatcagtggtttccggctattgcgctttctgccttattgggagaggaaaatttcacacag
gattcttttaagacaggccgaaaaatcctgatcagaattgacccgacgattcaccaacca
gaagtgatgattatcgttgatgctcttgaaagccaaagacaggttttagttcaaagcctc
gaaaaaaatttccaagctgtgcacggtattagtggggttgcttttctacaagaaggtcaa
acggctctagttattgacatagactccttattaaaccctcacaaatacagttaa

DBGET integrated database retrieval system