KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0633Help
Entry
Zmob_0633         CDS       T01875                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zmm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:zmm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743528..744721
Genome map
AA seq 397 aa AA seqDB search
MVADLTSDISESQEQETETNSANNNGAVFRPENCPRLVIKIGSSLLVDQRGQVRRDWLQT
VAYDIAKLHQAGQQIIVVSSGAIALGARRLNLPRGGRASLEDAQASASVGQILLSQCWAE
LLGACSLDSSQILLTLDDLEDRRRYLNVSATLDRLLSLGVVPVINENDSIATAEIRFGDN
DRLAARIGQASHASGVILFSDVDGLYTANPMKDPNAKRIDRVEHIDNSTEAMASSDSASG
MGSGGMASKVEAARIATYSGVNLAITTGKRPSPLTMFLDDGAGTLFTADESASAHKTWLA
GRLTAHGQVYIDQGAVEALHDGNSLLPAGVCSIEGKFNRGDVVDILDQEHNLIARGLIEY
DSEDSAQITGKRSQEIADILGYEARTALIHRNHMVML
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctaacttctgatatttcagaatcccaagagcaagaaacagaaactaac
tctgccaataataacggtgcggttttccgaccggaaaactgcccgcgactggttataaaa
attggttcttctttgctcgttgaccaacgcggtcaagttcgtcgcgattggctgcaaact
gtcgcctatgacattgccaaattgcatcaagctggacagcaaatcattgttgtttcctca
ggtgctatcgcactgggtgccagacgcttgaacttgccacgcggtggacgggcatccttg
gaagatgctcaagcctcggcttctgtcggacaaattttgcttagccaatgctgggcagaa
ttgctgggtgcatgcagcttggattcatcccaaattctactgacactcgatgatctagaa
gatcgccgccgctatcttaacgtctcggctacgcttgatcgcctgctttctcttggtgtc
gtgccagtcatcaatgaaaatgactcgattgcgaccgcagaaattcgttttggagataat
gaccgtctcgctgctcgtatcgggcaggccagccatgcctctggcgttatcctcttttcg
gatgtggatggcctttacacggccaaccccatgaaagatcccaacgccaaacggattgat
cgggtcgaacatatcgacaatagcacagaagccatggctagcagtgattccgcttccggc
atgggttctggcggcatggcttccaaggtagaagcggcgcgcatcgccacctattccggc
gttaatctcgcgattacaacgggtaaacgcccttccccgctgacgatgtttttggatgat
ggtgctggcacgctattcacagccgatgaaagcgcttcagctcataaaacatggctggcc
ggacgattaaccgctcatggtcaggtttatatcgatcaaggcgcagtcgaggcactccat
gatggaaacagcctgctccctgcgggcgtctgctccatagagggcaaattcaaccgcggt
gacgtggtcgatatcctcgatcaagaacacaaccttattgcgcggggtctgatcgaatat
gacagcgaagattctgcccaaatcacaggcaagcgatcgcaggaaattgctgatattcta
ggatatgaggccagaacagccctgatccatcgcaatcatatggttatgctatga

DBGET integrated database retrieval system