KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0678Help
Entry
Zmob_0678         CDS       T01875                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Zmob_0678
Enzymes [BR:zmm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Zmob_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(799934..800575)
Genome map
AA seq 213 aa AA seqDB search
MIARLVGFLVEKNSDSAIIDVNGVGYLVQLSGRALDYFSEIEGEITVHIETQIREDSITL
FGFASYLERDWFRLLTSVQGVGGKAALAILTALTCDAISVAISSGDKTMICRANGIGPKI
AQRIINELKEKPAAIALFSSAKGDHLAVEDISQPAASAHHAGNFVADAVSALLNLGFKPA
EAQRVVQLASEELGDQATLDSLVRLALRLSSKH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcgattggttggttttctggtagaaaaaaattctgattctgcgatcattgac
gttaatggcgtcggctatctcgtccaattatcaggacgcgctttagattatttctccgaa
attgaaggtgaaattaccgtccatatcgaaacccaaattcgggaagattcgattaccctt
tttggttttgcttcttatttggaacgggattggttcaggcttttaacgtcggtgcaaggc
gtgggaggcaaagcagctctggctattttaacggcgttgacctgcgatgcgatttctgta
gcgatttccagtggcgacaagaccatgatttgtcgcgccaatgggataggccccaaaatt
gcccagcgtattatcaatgaattgaaagagaaaccggcggctattgctttgttttcttct
gccaaaggcgatcatttggcggttgaagatatttcccagccagcagcctctgcccatcat
gcgggtaatttcgtggcagatgcggtgtctgcgcttttgaatttagggtttaaaccggct
gaagcgcaacgcgttgttcaattggcttcggaagaattaggcgatcaagcaacattagat
agtcttgtacgtctggctttacggttatcttccaagcattaa

DBGET integrated database retrieval system