KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0741Help
Entry
Zmob_0741         CDS       T01875                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm02020  Two-component system
zmm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Zmob_0741
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Zmob_0741
Enzymes [BR:zmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Zmob_0741
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Zmob_0741
Two-component system [BR:zmm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Zmob_0741
Bacterial motility proteins [BR:zmm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Zmob_0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AEH62582
UniProt: A0A0H3G184
Position
872062..873120
Genome map
AA seq 352 aa AA seqDB search
MTVKVLIVDDSPTMRAILSMMISSDPEIEVVGKADCPSTARQMIKELNPDVMTLDIEMPG
MDGLDFLEKVMRLRPMPVIMVSALTAAGAEATLKAMELGAFDCFAKPALGFASDKSQSQT
LISMIKAAAKNGGHRPLSFRNRSASAQNAAPAPSSVASGYRPKPGSIIAIGASTGGVETL
LALLKDFPANCPPTLIVQHMPPLFTASFANRLDRMCPPKVSEAKTGDPLTPGHIYIAPGG
ERHLEFQNAAHGPRCLLVSDEPMSGHRPSVDRLFLSVAKNCGRRAIGIILTGMGQDGAMG
LKAMRDTGSFTIGQDEESCVVYGMPAAAYRMGAVESQLPLSRIAAKALEACA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcaaagtacttatcgtcgatgactcgccaacaatgcgtgctatcctatccatg
atgatttcgtcagatccggaaatcgaagtcgtcggcaaagcagactgtccctctacagcc
cgccagatgattaaagaactcaatcccgatgtcatgacgctggatattgaaatgccgggc
atggacggattggattttcttgaaaaggtgatgcggctgcgtccgatgcccgtcatcatg
gtctcggccttaaccgcggcaggtgccgaagccaccttaaaggctatggaattaggtgcc
tttgactgctttgccaaacctgcgctcggctttgcctctgataaaagtcaaagccagacg
ttaatcagcatgatcaaggccgctgccaaaaacggaggccatcgcccactttctttccgc
aaccgttcggcctctgcccaaaatgcagcgcccgctccatcaagtgttgcttccggctat
cgtccgaaaccgggcagcatcattgctatcggtgcttcaactggcggtgtcgaaacgctg
ttagctttgctgaaagattttccggccaattgcccgccgactttgatcgtgcagcatatg
cctcctttattcacagcgagctttgcgaaccgtcttgatcgaatgtgtcctcccaaggtg
tccgaagccaaaactggtgatcctttgacaccggggcatatttacatcgctccgggtggg
gaacgccatcttgaattccaaaatgctgcccatggaccgcgctgtctcttggtctccgat
gagccgatgtcgggtcatcgcccttcagtcgatagattattcttatcggttgccaaaaat
tgcggtcgtcgagcaatcggtattattctgaccggtatgggacaagatggtgcgatggga
ctgaaagccatgcgcgatacaggttcctttaccattggacaggatgaagaaagctgcgtt
gtttacggaatgcccgctgcggcttatcgtatgggcgccgttgaaagccaactgccctta
tcccgtattgccgccaaagcgttggaggcctgcgcctaa

DBGET integrated database retrieval system