KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_0869Help
Entry
Zmob_0869         CDS       T01875                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zmm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:zmm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021560..1022057
Genome map
AA seq 165 aa AA seqDB search
MPSLSEIMLIFARAQNGVIGKDNTMPWHISADLKHFKALTLGHPMIMGRRTFESLPGLLP
KRPHIVLTHNHHWQAEGAEAVCDLEEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELT
EIYRDYSGDTFVDLPDMNHFSLVGQEDFKAEGECPAFSFKSFLRK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccttctttatctgaaataatgcttatttttgcccgcgctcaaaatggcgtaattggc
aaggataacaccatgccttggcatatttctgctgatttgaaacattttaaggccttaacg
cttggtcatccgatgattatggggcggcggacttttgagagtttgcccggcttgctgccg
aaaaggccacatattgttttgacccataatcatcattggcaggcggagggtgccgaagcc
gtttgtgatttggaagaggccataaaagctgctcggaaatatagtagccagatcgcggtg
attggtggagccaatatttttcaacaattttgggataaagcggatcggatcgaactgacc
gaaatttatcgcgattattccggtgatacctttgtcgatttgccggatatgaatcatttt
tctttggtaggacaagaggattttaaagcagaaggtgaatgccctgcttttagtttcaaa
tcatttctaaggaaataa

DBGET integrated database retrieval system