KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1035Help
Entry
Zmob_1035         CDS       T01875                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Zmob_1035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zmob_1035
   00020 Citrate cycle (TCA cycle)
    Zmob_1035
   00620 Pyruvate metabolism
    Zmob_1035
Enzymes [BR:zmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Zmob_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213577..1214899
Genome map
AA seq 440 aa AA seqDB search
MSIEVKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKIL
VPEGSENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDAS
LDKAISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKA
DIEAFVAEANQASSNPSVSTPEASGKITHDTPHNSIKLSNMRRVIARRLTESKQNIPHIY
LTVDVQMDALLKLRSELNESLAVQNIKISVNDMLIKAQALALKATPNVNVAFDGDQMLQF
SQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQPQEYQGGTSSIS
NMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGSFDHRVIDGADA
AAFMSAFKHLVEKPLGILAQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtcaaaatgccagcgctttcgcctacaatgacagaaggcacccttgcg
aaatggctggtgaaagaaggggatgccgttaaggcgggcgatattctggccgaaatcgaa
accgataaagcgattatggaatttgaaacggttgatgcagggatcatcgctaaaattcta
gtgccggaaggtagtgaaaatattgctgtaggtcaggtgattgctgtcatggccgaagcg
ggcgaagatgtttctcaagtcgccgcttctgcttcatcacagatatcagaaccttctgaa
aaagcagatgtcgcacagaaagagacggcagatagcgaaacgatatccatcgatgcctct
ctcgataaggcaatcagcaacgcaggttacggcaacaaaacagagaatatgacggcttcc
tatcaagaaaaagcagggcggataaaagccagtcctttggccaagcgtttggctaagaaa
aaccatgttgacctgaaacaggtaaacggtagtggcccccatgggcggattatcaaagct
gatattgaagccttcgttgctgaggctaatcaagcctcttctaatccgtcagtctctacg
ccggaagcctccggtaaaataacgcatgatacgccccataatagcatcaagcttagcaat
atgcggcgcgttattgctcgtcgtctgactgaatccaaacaaaatattcctcacatctac
ttgacggttgatgtccagatggatgctcttttgaagctccgctctgagctcaatgaatcc
ttagctgttcagaatattaaaatctcagtcaatgacatgctgattaaagcacaggcctta
gccttaaaagcaacgcctaacgtcaatgttgcttttgatggcgatcagatgctgcaattc
tcacaggccgatatctctgtcgctgtctctgttgaaggtgggctgattacgcctatcttg
aaacaagctgataccaaaagcttgtctgcgctttctgtcgaaatgaaagagcttattgct
cgcgcaagggaagggcgcttgcaacctcaggaatatcaaggcggaacgtccagtatttct
aatatggggatgtttggtatcaagcagtttaatgctgtcatcaacccgccacaggcttct
atcttggcgattggaagcggtgaaagacggccttgggtgattgatgatgcgatcaccatt
gctaccgttgcaactatcaccggtagttttgatcatcgtgttattgatggtgccgatgcg
gctgcctttatgtcagccttcaagcatttggttgaaaaaccattagggattttagcacaa
tga

DBGET integrated database retrieval system