KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1072Help
Entry
Zmob_1072         CDS       T01875                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zmm01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:zmm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241951..1242745)
Genome map
AA seq 264 aa AA seqDB search
MSNILTEICATKAEFVAERKKQIGNNALLDLIKAQTQPRGFRAALEKKRARGQFGLIAEI
KKASPSKGLIRSDFTPAAHARDYEEGGAACLSVLTDRPYFQGHEDYLIAARQAVKLPVLR
KDFMIDPWQVTEARAIGADAILIIVAALDDQQMQDIEAAALEYGMDALVEVHSHDEMERA
LKLKSRLIGVNNRDLRDFSVSFDRTYELVGSAPKDCTFVAESGIRNHDDLVAMQRHDIGC
FLVGETLMRQDDLRKATKDLLGLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattcttacagagatctgcgccaccaaggcagaattcgtggcagaacgaaaa
aaacagattgggaataatgcccttcttgatttgataaaggcacagacgcaaccccgtggt
tttcgagctgccctagaaaaaaagagagcgcgagggcaattcgggcttattgcagaaatc
aaaaaagctagcccttcaaaagggttaatccgttctgattttacaccagcagcccatgcc
cgtgactatgaagaaggcggtgcagcctgtttatccgttttaacagatcgcccctatttc
caaggccatgaagattatttaatcgcggccagacaagcggtaaagttacccgtccttcgt
aaagattttatgattgacccgtggcaggtaaccgaagctagagccatcggtgccgatgcg
atcttgattatcgttgcggccttggacgatcaacagatgcaggatattgaagccgccgct
ttagaatatggcatggatgctttggtagaagtccatagtcatgatgagatggagcgggcg
ttaaaattgaaatcccgtcttattggcgtcaataatcgcgatttgcgagacttttcggtc
agttttgaccgcacctatgaattagtgggttcagcccccaaagattgcacctttgttgcg
gaaagcggtatccgcaatcatgatgatttggtggctatgcagcgtcatgacattggctgt
tttttagtaggtgaaactttaatgcggcaagatgatctgagaaaagccacaaaggattta
ttgggattatcctaa

DBGET integrated database retrieval system