KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1095Help
Entry
Zmob_1095         CDS       T01875                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00020  Citrate cycle (TCA cycle)
zmm00190  Oxidative phosphorylation
zmm00650  Butanoate metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01120  Microbial metabolism in diverse environments
zmm01130  Biosynthesis of antibiotics
zmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Zmob_1095
   00650 Butanoate metabolism
    Zmob_1095
  Energy metabolism
   00190 Oxidative phosphorylation
    Zmob_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEH62928
UniProt: A0A0H3G294
Position
complement(1270899..1271285)
Genome map
AA seq 128 aa AA seqDB search
MMNSYSDSPLSGNHRYRDSHRTDFYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWVA
QTIVALPMIFLAISTYGYACSFVDKLFSEERFPKAGLYFQIAAYFYMIIFAAIAVFSILK
IAFHSSIS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcttacagtgacagcccgctatctggaaatcaccgttatcgtgatagccat
cgaaccgatttttataaaaaactcacggcggcggctaatcttcttttatatgtttggttg
atcgtctcttttctggaattaccggtctatgattttaatgtcattagacgttgggtagcc
cagaccatagtcgccttgccgatgatttttctggccatatcgacctatggctatgcctgc
tcttttgtggataagctgttttcagaggagcgttttccaaaagcagggctgtatttccag
atagccgcctatttttacatgataatttttgcagcgatcgcggtcttttcaattctgaaa
atcgcttttcattctagtataagctaa

DBGET integrated database retrieval system