KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1095Help
Entry
Zmob_1095         CDS       T01875                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Zmob_1095
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Zmob_1095
   00650 Butanoate metabolism
    Zmob_1095
  Energy metabolism
   00190 Oxidative phosphorylation
    Zmob_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270899..1271285)
Genome map
AA seq 128 aa AA seqDB search
MMNSYSDSPLSGNHRYRDSHRTDFYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWVA
QTIVALPMIFLAISTYGYACSFVDKLFSEERFPKAGLYFQIAAYFYMIIFAAIAVFSILK
IAFHSSIS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcttacagtgacagcccgctatctggaaatcaccgttatcgtgatagccat
cgaaccgatttttataaaaaactcacggcggcggctaatcttcttttatatgtttggttg
atcgtctcttttctggaattaccggtctatgattttaatgtcattagacgttgggtagcc
cagaccatagtcgccttgccgatgatttttctggccatatcgacctatggctatgcctgc
tcttttgtggataagctgttttcagaggagcgttttccaaaagcagggctgtatttccag
atagccgcctatttttacatgataatttttgcagcgatcgcggtcttttcaattctgaaa
atcgcttttcattctagtataagctaa

DBGET integrated database retrieval system