KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1095Help
Entry
Zmob_1095         CDS       T01875                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:zmm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:zmm00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:zmm00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:zmm00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270899..1271285)
Genome map
AA seq 128 aa AA seqDB search
MMNSYSDSPLSGNHRYRDSHRTDFYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWVA
QTIVALPMIFLAISTYGYACSFVDKLFSEERFPKAGLYFQIAAYFYMIIFAAIAVFSILK
IAFHSSIS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcttacagtgacagcccgctatctggaaatcaccgttatcgtgatagccat
cgaaccgatttttataaaaaactcacggcggcggctaatcttcttttatatgtttggttg
atcgtctcttttctggaattaccggtctatgattttaatgtcattagacgttgggtagcc
cagaccatagtcgccttgccgatgatttttctggccatatcgacctatggctatgcctgc
tcttttgtggataagctgttttcagaggagcgttttccaaaagcagggctgtatttccag
atagccgcctatttttacatgataatttttgcagcgatcgcggtcttttcaattctgaaa
atcgcttttcattctagtataagctaa

DBGET integrated database retrieval system