KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1110Help
Entry
Zmob_1110         CDS       T01875                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Zmob_1110
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zmob_1110
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zmob_1110
Enzymes [BR:zmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Zmob_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1289153..1290379)
Genome map
AA seq 408 aa AA seqDB search
MKQSNSVLPNSLRAQPDAGGHFGTFGGQYVPETLMPLILELNQEYRRALKDPSFIAERDD
LLEHYVGRPSPLYFAPRLTEAWGGAKIYLKREDLNHTGAHKINNCIGQVLLAKRMGKTRV
IAETGAGQHGVATATVAARFGLSCTVFMGELDTERQQPNVFRMKLLGAEVRPVKAGSRTL
KDAMNEALRDWVAHIDDTFYILGTAAGPHPYPEMVRDFQSVIGREAREQIQKAEKRLPDL
LIAAVGGGSNAMGLFHPFLDDTDVAMIGVEAAGEGMETGRHAASLTGGAPGIVHGNRTYL
LYDENGQIKDAHSISAGLDYPGIGPEHSWLKDIKRVRYETITDNEALAAFQQLCRLEGII
PALESSHALAEAAKIAPTMGKDKVIIVNLSGRGDKDIYTVASHLGVAL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatctaattctgttcttccgaattctcttcgcgcccaacctgatgcaggaggg
cattttggcacattcggcggacaatatgttcccgaaaccctgatgcctttaattcttgag
cttaatcaggaatatcggcgcgcattgaaagacccgtcattcatagcagaaagagatgat
ctgctagagcattatgtcggtcgtcctagcccgctttatttcgcgcctcgcctgacagaa
gcctggggcggcgcaaaaatctatttgaagcgtgaagatcttaatcacacgggtgcgcat
aaaatcaataactgcatcggtcaggtcttattagcgaaaagaatgggtaaaacccgcgtt
atcgcggaaaccggtgccggacagcatggtgtcgcaacggcgaccgttgcggctcgcttt
ggtctatcttgcacggtctttatgggtgaactggatacagagcgccagcaacccaatgtc
tttagaatgaaattgttaggtgccgaggttcgtcccgttaaagcgggttcccgcacctta
aaagatgccatgaatgaagccctgcgtgattgggtggctcatattgatgacactttctat
attcttggcacggcagcaggcccccatccatatcctgaaatggtgcgtgatttccaatcc
gtgattggacgcgaagccagagagcagattcaaaaagcagaaaagcgtttaccggattta
ttgatcgcagccgttggcggtggatcaaatgctatggggcttttccatcctttccttgat
gatacagatgtcgctatgattggtgtcgaggctgccggtgaaggcatggaaaccggtcgt
catgcagccagcttaacgggcggcgcaccgggtatcgtccatggaaaccgcacctatctt
ctttatgatgagaatggtcagattaaagatgcccattcgatttcagccggtcttgattat
ccgggtattggccctgaacatagctggttaaaagacataaaacgtgtccgttatgaaacc
attacggataacgaagccttggccgctttccagcagctttgccgattagagggtattatt
ccggcattggaatcttcccatgctttggcagaagccgccaaaatagccccgacaatgggc
aaagacaaagtcattattgttaatctttcagggcgtggcgacaaagatatctataccgta
gccagccatttaggggtcgcgttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system