KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1267Help
Entry
Zmob_1267         CDS       T01875                                 

Definition
uroporphyrinogen-III synthase-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:zmm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1462631..1463359
Genome map
AA seq 242 aa AA seqDB search
MLREWQLNNRVQDKLLILRPEPGATATAKRAEKVGWQVIKTPLATAISIPWSINESLSFD
AVMVTSAQAIYHGGSELDKLKDYPLYVVGKATEAAARQAGFQHIVTAEGNGASVLCCLER
DKRMRILRLCGEIYKDYDYKNFSLKENTQFFIKILYRMQNIASLPIEACQALVENAIVLL
HSSRFAEQFRLLLAKTDINPDRVQIAVISPAVAEQIGKEWRAMAIAEYPDDTSLLKAAAS
LK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgagagaatggcaattaaataatcgtgttcaagataaattattgattttacgcccc
gagccgggggcaaccgctacagccaagcgtgcagaaaaagtaggctggcaagtaataaaa
acgcctcttgcaacggctatatcgataccttggtcaataaatgaatctctatcttttgat
gcggttatggtaacgagtgcccaagctatttatcacggaggaagtgaactggataaatta
aaagactatcctctttacgtggttggcaaggctactgaggcggcggcacgtcaggcaggg
tttcagcatattgtaacggccgaaggtaatggcgcatctgtactttgttgtcttgaacgg
gacaaaagaatgcggatattaaggctctgcggcgagatttacaaagattatgactataaa
aatttttctctgaaagaaaacactcaattctttataaaaattctttatagaatgcaaaat
attgccagtttaccgatagaagcctgtcaggcattagtagaaaatgccatagtcctatta
cactcttctcgttttgcagagcaatttcgtcttttgcttgcgaaaacggatatcaatcca
gacagagttcagattgctgttattagcccagcagtagcagaacaaattggaaaagagtgg
cgagcaatggcaatagctgaatatcctgatgacacatctttgttaaaggcggcagctagc
ttgaaatga

DBGET integrated database retrieval system