KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1277Help
Entry
Zmob_1277         CDS       T01875                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Zmob_1277
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zmob_1277
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Zmob_1277
Enzymes [BR:zmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Zmob_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1472690..1474087
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPENWPAFSREDIAALAGLSYVDTAVAVMR
PFVSGVLDDQALKNLCGAAYGQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLSEEKGQDLTIVGATSGDTGSAAISAVAGRAGVQIVMLHPNGRVSEVQRRQMTT
VLDKNVHNVAIDGSFDDAQAIVKAMFNDSDFRKRHRLGAVNSINWARLMAQIVYYFYAAV
RLGAPDRKVAFSVPTGNFGDVFAGYAAKKMGLPVEKLIVATNINDILYRALSAGDYSVGN
VTPTDAPSMDIQISSNFERLLFDLHGRDAASLAATMAQFEQSRAIQISDAMRQQAATIFS
SKRIDPDEMAATMRWASDKAGQVIDPHTAIGLAAARETDLPKDVPVVTLATAHPAKFPDA
VSRITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDAGFQL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaaggggcgcggcagccgcgcaggattttaagggcgttacctta
accgggcttgcctcggatggtggtctctatgtgccagaaaattggccagccttcagccgc
gaggatatcgctgcattagcaggattgtcctatgtcgatacggctgttgcggttatgcgg
ccatttgtcagcggtgtgctcgacgatcaggcattaaaaaatctgtgcggagccgcttat
ggtcagttcaaccatgcagctgttacgccgttggttcagttagatgaacggcatttcttg
ctggaattatttcatggcccgaccttggctttcaaggatgttgctttacaacttctaggt
catttatttgaaaaattcctttccgaagaaaaaggacaggatctgacaatcgtcggagca
acctccggtgatactggatcggcggctatatctgctgttgctggacgagctggcgtgcaa
attgtgatgttgcatcccaacggtcgggtttccgaagttcaacgtcgccaaatgacgacg
gttctcgacaaaaatgtccataatgtcgcgattgacggtagctttgatgatgcacaggct
attgtcaaagccatgttcaacgatagcgactttagaaaacgtcatcgtctgggcgctgtt
aattcgattaactgggctcgcttgatggctcagatcgtttattatttctatgcggctgtt
cgtcttggtgcacctgatcggaaagtcgctttttctgttcctactggtaactttggtgat
gtttttgcgggttacgctgccaaaaaaatggggcttcctgtcgaaaaattgatcgttgcg
actaacatcaatgatatcctttatcgggcattgtcagccggtgattattctgtcggtaat
gtaaccccgaccgatgcgccgtcgatggatatccaaatcagttccaattttgaacgcttg
ctttttgaccttcatggtcgggatgcggcttctttggcggcaacaatggcgcaatttgaa
cagagtcgtgctattcagatttctgatgcaatgcgccagcaagctgcaacgatattcagc
agcaaacgcattgatcccgatgaaatggctgcgaccatgcgttgggcttccgataaagca
ggacaggttattgatcctcatacggctattggtttggcggccgcccgtgaaacagatctt
ccaaaggatgttccggttgttactttggcaacggctcatccggcaaaattccctgatgct
gtttcccgtattacgggtaaaaacgctcctctgccgcatcgtttggctgatctttacagc
cgtgaagaacgctatgttgaactgcctgcgtcacgtcagacaattcaggcttatattgat
gccggattccagctttga

DBGET integrated database retrieval system