KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1287Help
Entry
Zmob_1287         CDS       T01875                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00860  Porphyrin and chlorophyll metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Zmob_1287
Enzymes [BR:zmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Zmob_1287
Exosome [BR:zmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Zmob_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEH63111
UniProt: A0A0H3G7I6
Position
complement(1484077..1485078)
Genome map
AA seq 333 aa AA seqDB search
MSLVPTQYPATRLRRLRASAWSRSMHSENVLTPADFIWPLFVTGGKGVKEAVQSMPGVFR
WSVDLIVEQAKLAHSLGIPCLALFPNTDIAKRSEDGREAWNADNLMCQAIRAIKDAVPDI
GLLTDVALDPYTSHGHDGVIDAQGYVLNDETKELLIKQARVQAEAGADIIAPSDMMDGRV
AAIRDMLESEGHRNVQIMSYAAKYASVFYNPFRDAVGSAGIFKADKKTYQMDPANSDEAL
REVAMDIAEGADSVMVKPGLPYLDVLYRVKESFKLPVFAYQVSGEYAMLEAAFAAGMLDK
DKAVLETLTCFKRAGAAGVLTYHAVHAAKLLNG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagtccctacacaatatccggcaacgcgcctgcgtcgcctccgtgcttccgct
tggagccggagcatgcattccgaaaatgtcttgacccctgccgactttatctggccgtta
tttgtgacgggtgggaaaggcgtgaaagaggccgttcaatctatgcccggcgttttccgc
tggtctgttgatctgattgttgaacaagccaaattagcgcacagcctcggcatcccttgt
ctggccttattcccgaataccgatatcgccaaacgcagcgaggacggtcgggaagcatgg
aatgctgataatctgatgtgtcaggctattcgcgccatcaaagacgcggttcccgatatc
ggcttgttaaccgatgtcgccttggatccttataccagccatggtcacgacggcgttatt
gatgcgcagggctatgttctgaatgacgaaaccaaagaattactgattaaacaggctcgg
gttcaggccgaagccggtgccgacattattgccccttccgatatgatggatggacgggtt
gccgctatccgcgacatgctggaaagcgaaggccatcgcaatgtccagatcatgtcctat
gccgctaaatatgcgagcgttttttataatcccttccgtgatgcggtcggttcggctggt
attttcaaagccgacaagaagacctaccaaatggatccggctaatagtgatgaagccttg
cgcgaagtcgctatggatatcgcagaaggcgcagacagcgtcatggtcaaacccggcctt
ccttatctcgatgtgttatatcgcgtaaaagaaagctttaaattgccggtctttgcctat
caggtctctggtgaatatgcgatgttagaagccgcctttgcagccggtatgctcgacaaa
gataaggccgttctagaaaccctaacctgcttcaaacgcgctggagccgcaggtgtttta
acctatcatgcggttcatgcggcaaagcttttgaatggctaa

DBGET integrated database retrieval system