KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1379Help
Entry
Zmob_1379         CDS       T01875                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:zmm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:zmm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zmm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:zmm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1589254..1590120
Genome map
AA seq 288 aa AA seqDB search
MKPVRKAIFPVAGQGTRFLPATKAMPKEMLPVVDRPLIQYAVDEARAAGIEELIFVTGRG
KQAIEDYFDIAYELEVSLVAKGKTEMLDLLEGTRVAPGRACFIRQQEPLGLGHAVWCARD
LIGDEPFAVLLPDELLWNPEKPSLVQLVETYNQKGGNVVTVMEVPEEHTHRYGIVDPGKT
DGEVTEVKGLVEKPEKAPSRLAMTGRYILQPDIMPLLAQDNRGVGGEIQLTDSMAQLIGK
QPFHACRFGGIRHDCGDKAGFIQANVALALERPDIGPAVRDYLHRQNF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtccgtaaagcaattttccctgttgccggccaaggcacccgctttttgcca
gcaaccaaggccatgcccaaggaaatgctgccggtcgttgatcgccctttgattcaatat
gctgtcgatgaagcacgggcagccggcattgaagaactgatctttgttaccggacgtggc
aagcaggctatcgaagattatttcgatatcgcctacgaattggaagtttctttggttgcc
aagggcaaaaccgaaatgctggatttgctggaaggtacgcgggtggctccgggtcgtgcc
tgtttcattcgacaacaggaaccgttgggtttaggacatgctgtctggtgcgcccgtgat
ttgatcggcgatgaaccttttgctgttcttttgcccgatgaattactttggaatcctgaa
aaacccagtctggtgcaattggttgagacctataaccagaaagggggtaacgtcgtaacc
gtgatggaagtccccgaagagcatacccatcgttatggtatcgttgaccccggtaaaact
gacggcgaggttaccgaggtgaaaggtctggttgaaaaaccggaaaaagccccttcgcgg
ttagccatgacgggacgttatattctccaaccggatattatgcctttattggcacaggat
aatcgcggtgtcggtggtgaaattcagttgacggattcgatggcacagctgatcgggaag
caaccttttcacgcttgtcgctttggcggtattcgccatgactgcggtgataaggccgga
tttattcaggcaaatgttgcgttagccttggaaagacctgatataggccctgcggttaga
gactatctacatcgccaaaatttttaa

DBGET integrated database retrieval system