KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1493Help
Entry
Zmob_1493         CDS       T01875                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Zmob_1493
Enzymes [BR:zmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Zmob_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1709529..1710080
Genome map
AA seq 183 aa AA seqDB search
MLYAIALGSNRWHGRYGRPSAVIEAAIAALEKEKIAIHSRAPIFETSAVGPGGRRYANSA
IIIKTDLQPLALLALCKKVEQAFGRRKGQRWGARVLDLDIVLWEKGRWPRKIQPRLRYKP
ALAAGQPPALWPKLHIPHLEISRRDFVLKPLLSIAGNWPVFQKNGFFTVKQLYFRYKYLT
SKQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgctttacgctatcgcactaggctctaatcgttggcatggtcggtatggtcggccatct
gcggtcatcgaggcggcgattgctgcattggaaaaagaaaagattgcgatccattctcgc
gctccgatttttgaaacctcagctgtcgggcccggtggacggcgttatgccaattccgcg
attattattaaaacagatttacagccgcttgcattgctggcgctttgtaaaaaagtagaa
caggctttcggcagacgaaaagggcaaagatggggggcgagggtgctcgatcttgatatt
gtcttatgggaaaaaggccgctggccacgaaaaatacaaccccgccttcgctacaagcct
gccttggctgcaggacaaccaccggctttatggccaaaacttcatattccccatcttgag
atcagtcgtcgcgattttgtactgaagcctctgctttcgatcgccggaaattggcctgtt
tttcaaaaaaatggattttttacggtaaaacagctatattttcgctataagtacttgacc
tccaagcaataa

DBGET integrated database retrieval system