KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1637Help
Entry
Zmob_1637         CDS       T01875                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
zmm00020  Citrate cycle (TCA cycle)
zmm00640  Propanoate metabolism
zmm00660  C5-Branched dibasic acid metabolism
zmm01100  Metabolic pathways
zmm01110  Biosynthesis of secondary metabolites
zmm01120  Microbial metabolism in diverse environments
zmm01130  Biosynthesis of antibiotics
zmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Zmob_1637
   00640 Propanoate metabolism
    Zmob_1637
   00660 C5-Branched dibasic acid metabolism
    Zmob_1637
Enzymes [BR:zmm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Zmob_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEH63451
UniProt: A0A0H3G0B2
Position
1898223..1899419
Genome map
AA seq 398 aa AA seqDB search
MNIYEYQAMALLNERGVSVVPGYMAANVEEAVKAAEQLSSPPYVIKSQILAGGRGKGYFR
ESPKEGGGVRLVSDIAAVKKQAESMLGRHLVTAQTDDQGIPVEKLLITEAVSIAREFYLS
LLVDRQTGRVTFVASPEGGMDIETVAKEKPEAIHRIAIDPATGFQPHHGRMIGFALGLSG
DVFKQGIKLAASLYKAFTTSDMSLLEINPLVETNDGKLLPVDAKISFDDNALFRHPDIAA
LGEAGASDPLEQEARQAGLSYIKLDGSIGCMVNGAGLAMGTMDIIQLHGEMPANFLDVGG
GASKEKVAAAFRIILSDPSVKGILVNIFGGIMRCDILAEGIIAAARELDITVPLVVRLEG
NNVNEGKAALVSSGLPIITASDLGDAAQKIVAAIRQTA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatatacgaatatcaggcgatggctcttttgaatgaacggggtgtctcggttgtc
cccggttatatggccgccaatgtagaagaagccgtcaaagcggcagaacagctttcctct
cctccttatgtcatcaaatcccagattctagccggtggtcgcggcaaggggtatttccgc
gaatctccgaaagagggcggtggcgtccgtttggtctctgatatcgccgctgtcaaaaaa
caggcagaatcaatgctcggtcggcatttggtcactgcccagacggatgatcagggtatt
ccggttgaaaaactgttgattaccgaagctgtctctattgctcgcgaattttatctttcc
ctgttggttgatcgccagacggggcgggtgacctttgtcgcttcacccgaaggcggtatg
gatatcgaaaccgttgccaaagaaaaaccggaagctattcaccgtatcgctattgatcca
gcaacaggcttccaaccacatcatggtcggatgattggttttgcgctgggcttgtccggt
gatgtcttcaaacaaggcatcaaattagccgccagcttgtataaagcctttacgacttcg
gatatgagtctgcttgaaatcaaccccttggtcgaaaccaatgacggtaaacttttaccc
gttgatgccaaaatcagctttgacgataatgcgctattccgccaccctgatattgcggcc
ttaggggaagcaggtgcttctgatcctttggaacaagaagcccgtcaggccggtttatcc
tatatcaagctggatggtagcatcggctgcatggtcaatggtgcagggcttgctatggga
acgatggatataatccagcttcatggcgagatgcctgccaacttcttggatgtcggtggc
ggtgccagcaaagaaaaggtggctgccgcttttcggattattctttctgacccatccgtc
aaaggtattttggtcaatatcttcggtggaattatgcgttgcgatatcctcgcagaaggc
attatcgccgccgctcgtgaactggatataacagtgcctttggtcgtccggttagaaggc
aacaatgttaacgaaggtaaggccgctcttgtctcttcaggattgcctattattacagcc
agtgatctcggcgatgccgctcaaaaaatcgtagccgctatccggcagactgcctga

DBGET integrated database retrieval system