KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1657Help
Entry
Zmob_1657         CDS       T01875                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Zmob_1657
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Zmob_1657
Enzymes [BR:zmm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Zmob_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922570..1923121)
Genome map
AA seq 183 aa AA seqDB search
MQFKRLSIPEVIVIAPPKYIDSRGFFSETYNENSMKKMGIDTPFVQDNQSLSRNKGVVRG
LHCQISPYIQGKLVRCPKGAIWDVAVDARFGSPTYGKWVAAEISEENWSQIWIPPGFLHG
FVTLTENTEVQYKCTSFYNKASERAVIWNCHRLNIPWPINHAEILLSEKDKTAPSFDETK
KWF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaaaagattatctattcctgaagttattgtgatagcacctcctaaatatatt
gatagtagaggttttttttcagagacatataatgaaaattctatgaagaaaatgggaatt
gataccccttttgttcaagataatcaaagcttatcacgaaataagggcgtagttagaggt
cttcactgtcagatatctccctatatacaaggtaaattagtccgttgtcccaaaggcgcg
atctgggatgttgcagttgatgcgcgttttggatcaccaacttatgggaagtgggtcgct
gctgaaatttctgaagagaattggtctcagatttggattccacctggttttcttcatggc
tttgtaacacttactgaaaatacagaagtgcaatataaatgtactagcttttataataaa
gcttcagagcgagctgtaatttggaattgtcatcgattaaatataccttggccaattaat
catgctgagatcctattatcagagaaagataaaaccgctccgtcatttgacgaaactaaa
aagtggttttga

DBGET integrated database retrieval system